KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1360Help
Entry
BP1026B_I1360     CDS       T02049                                 

Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:bpz00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1466602..1467240
Genome map
AA seq 212 aa AA seqDB search
MQRTDDVLLVIDVQNDFMPGGALAVAHGDEVVPAINRLAARFDHVVLTQDWHPRDHVSFA
ANHPGRAPFSTLALPYGEQVLWPVHCVQGTHGAALHGDLDIPHARLVVRKGHRASVDSYS
AFVEADRRTPTGLAGYLREIGAKRVWCCGLATDYCVAWSALDARAAGFDAAVIEDACRAI
DLDGSLARAWASLAAAGVARVQSAEVCPGVDP
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgcaccgacgatgtccttctcgtgatcgacgtgcagaacgatttcatgccgggc
ggcgcgctcgcggtcgcgcacggcgacgaagtcgtgccggcgatcaaccggctcgccgcg
cgcttcgatcacgtcgtgctgacgcaggattggcatccgcgcgatcacgtgtcgttcgcg
gcgaaccatccgggccgcgcgccgttctcgacgctcgcgctgccgtacggcgagcaggtg
ctgtggcccgtccactgcgtgcagggcacgcacggcgcggcgctgcacggcgatctcgac
atcccgcacgcgcggctcgtggtccgcaaggggcatcgcgcgtcggtcgacagctactcg
gcgttcgtcgaggccgaccgccgcacgccgaccgggcttgccggctatctgcgcgaaatc
ggcgccaagcgcgtgtggtgctgcgggctcgcgaccgactattgcgtcgcgtggtccgcg
ctcgatgcgcgcgccgcgggcttcgacgcggccgtgatcgaggacgcgtgccgcgcgatc
gatctcgacggctcgctcgcgcgcgcatgggcgtcgctcgccgcggcgggcgtcgcgcgc
gtgcagtcggccgaggtttgcccgggcgtcgatccgtag

DBGET integrated database retrieval system