KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1435Help
Entry
BP1026B_I1435     CDS       T02049                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BP1026B_I1435 (recR)
DNA repair and recombination proteins [BR:bpz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      BP1026B_I1435 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1545529..1546131
Genome map
AA seq 200 aa AA seqDB search
MSIKPPSALSELVEALRALPGVGPKSAQRIAYHLMQHDREGAERLGRSLLFATEHLRHCE
KCNTFTEAQICEVCSDPERDPALLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIG
PKEIHFDRLVRRASDGIVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGG
ELEYVDAGTIARAMLDRRTL
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcaagccgccgtccgcgctgtccgagctcgtcgaggcgctgcgcgcgctgccg
ggcgtcgggccgaaatccgcgcaacgcatcgcgtaccacctgatgcagcacgatcgggag
ggcgccgagcggctcggccggtcgctgttgttcgcgaccgagcacctgcggcattgcgag
aagtgcaacacgttcacggaggcgcaaatctgcgaggtgtgcagcgatccggagcgcgat
ccggcgctgctgtgcgtcgtcgagacgcccgccgatcagatcatgctcgagcagacgatg
acctatcgcgggctgtacttcgtgctgatggggcgcctgagcccgctcgacggcatcggg
ccgaaggaaatccatttcgaccggctcgtgcgccgcgcgtccgacggcatcgtgaaggag
gtcgtgctcgcgacgaacttcacgaacgagggcgaggcgaccgcgcactacctcggccag
acgttgaaggcgcgcggcctggccgtcacgcggctcgcgcgtggcgtaccggtgggcggc
gagctcgaatacgtcgatgcgggcacgattgcgcgcgcgatgctcgaccggcgcacgctt
tag

DBGET integrated database retrieval system