KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1438Help
Entry
BP1026B_I1438     CDS       T02049                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
Enzymes [BR:bpz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     BP1026B_I1438
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:1548269..1549237
Genome map
AA seq 322 aa AA seqDB search
MSGERAKRFPLALEDLKREPRKPEGRVAERQAAGDAARQRLTAAAAAPAAASPIVPERRA
PHGGVFAAKPARAKQHAPAAPGAAKRAPQGGAKQGDRSAAPNVALSGALALTSERVRERM
VERLRANGVADPRVLAAMSAVPRHMFVDPGLAAQAYEDAALPIGHQQTISKPSVVARMIE
LAAAGRALERVLEIGTGCGYQAAVLSRVARDVYSIERVKPLYERAKLNLRPLRVPNIRLH
YGDGRVGLPAAAPFDAIVIAAAGLDVPRALLEQLAIGGRLVAPVGEQAGEQVLTLVERVA
PAQWRESRLDRVFFVPLKSGVI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgagcgcgcgaagcggtttccgctcgcgctcgaggatctgaagcgcgagccg
cgcaagcccgagggccgcgtggcggagcgccaggcggcgggagacgccgcccgccagcgc
ctcaccgcggccgccgccgcgcccgccgctgcttctccgatcgtgcccgaacgccgcgcg
ccgcacggcggcgtgttcgccgcgaaacccgcgcgtgcgaagcagcacgcgcctgcggcg
cccggcgccgcgaagcgcgcgccgcaggggggcgcgaagcagggggaccggagcgccgcg
ccgaacgtcgcgctgagcggcgcgctcgcgctgacttcggaacgggtgcgcgagcgcatg
gtcgaacggctgcgggcaaacggcgtggccgatccgcgcgtgctcgccgcgatgtcggcc
gtgccgcgccacatgttcgtcgatcccgggctcgcggctcaggcgtacgaggacgccgcg
ctgccgatcggccatcagcagacgatctcgaagccgtcggtcgtcgcgcgcatgatcgag
ctcgcggcggcgggccgcgcgctcgagcgcgtgctcgaaatcggcacgggctgcggctat
caggccgcggtgttgagccgcgtcgcgcgcgacgtgtattcgatcgagcgcgtgaagccg
ctctacgagcgcgcaaaactgaatttgcggccgctgcgcgtgccgaacatccgcctgcac
tacggcgacggacgcgtgggcctgcccgccgcggcgccgttcgacgcgatcgtgatcgcg
gcggcggggctcgacgtgccgcgggcgctgttggaacaattggcgatcggcggcaggctc
gtcgcgcctgtcggagagcaggcgggcgagcaggtgctgacgctcgtggagcgcgtcgca
cccgcgcagtggcgcgagtcgcggcttgatcgcgttttctttgtccctttaaaatccgga
gtgatttga

DBGET integrated database retrieval system