KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1546Help
Entry
BP1026B_I1546     CDS       T02049                                 

Gene name
nosZ
Definition
nitrous-oxide reductase
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:bpz00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1669132..1671114)
Genome map
AA seq 660 aa AA seqDB search
MSENVMANSKENTEAAAAPQDARRRRFLASSAVAGLAGASLSLGLAGCNKGGDAPAAASG
AGASAASGAAAAPAIDFGKYEVHPGKLDTYYTFSSGGHSGDIRVHGLPSGREIRRIPVYN
IDCMSGWGITNESRKIIGTKANGQLEYFTGDTHHVHMSYTDGTYDGKYIFVNDKINARIA
RVRLDTMECDAITPLPNVQGFHGIFPDKRDPLDQTINYTTRVFCGNEFHIPHPNDGRDLN
DPKKYYCLFTCVDAKTMQPRWQVKIDGNMDLVATSYDGKLACSNQYNTENGVHYEEMMAA
ERDACVFFNVARIEEAVKNGKFFKVGNSPVPVVDGTRAANADPKTALTCYVSVPKNPHGV
NASPDGKYYACSGKLSPTATLISHELMLKWFAGELKEPRDAVVAEPEIGLGPLHTGFDGK
GYAYTTLFLDSQIVKWSLEEAIKAYKGEKAAKVVVDRIDVHYQPGHGFTSMGETKEPDGQ
FFISDNKFSKDRYLPVGPLHPDSAQLIDISGEKMLLVADHPTYPEPHDSIVVRRDIIKTR
QIYNLDEFPLAVKNAKDSRVERHGRKVTVYLTSQAPTFGLREWTVKKGDEVTIILTNLDK
VEDLTHGFAIPFYNINFVVHPQQTQSVTFIADKPGVFWCFCTNFCHALHLEMRSRMLVEA
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagaatgtgatggctaattcgaaggaaaacaccgaagcggcggcagcgccgcag
gacgcgcggcggcgcaggttcctcgcctcgtcggcggtcgcggggctcgcgggcgcgagc
ctgtcgctcggcctcgcgggctgcaacaagggcggcgacgcgcccgccgcggcgagcggc
gcgggcgcgagcgcggcgagcggcgcggctgcggcccccgcgatcgacttcggcaagtac
gaagtgcatccgggcaagctcgatacgtactacacgttctcgagcggcggccattcgggc
gacatccgcgtgcacggcctgccgtccgggcgcgagatccggcgcattcccgtctacaac
atcgactgcatgtccggctggggcatcacgaacgaatcgcgcaagatcatcggcaccaag
gccaacggccagctcgaatacttcacgggcgacacgcaccacgtgcacatgtcctatacg
gacggcacgtacgacggcaagtacatcttcgtgaacgacaagatcaatgcgcgcatcgcg
cgcgtgcgcctcgacacgatggagtgcgacgcgatcacgccgctgccgaacgtgcagggc
tttcacggcatcttccccgacaagcgcgatccgctcgaccagacgatcaactacacgacg
cgcgtgttctgcggcaacgagttccacattccgcacccgaacgacggccgcgacctgaac
gacccgaagaagtactactgcctgttcacctgcgtcgacgcgaagacgatgcagccgcgc
tggcaggtgaagatcgacggcaacatggatctcgtcgcgacgtcgtatgacggcaagctc
gcgtgctcgaaccagtacaacaccgagaacggcgtgcattacgaggaaatgatggcggcc
gagcgcgacgcgtgcgtgttcttcaacgtcgcgcgcatcgaggaagcggtgaagaacggc
aagttcttcaaggtgggcaactcgcccgtgcccgtcgtcgacggcacgcgcgcggcgaac
gccgatccgaagacggccctcacctgctacgtgagcgtgccgaagaacccgcacggcgtg
aacgcgtcgcccgacggcaagtactacgcgtgctcgggcaagctctcgcccaccgcgacg
ctgatctcgcacgagctgatgctcaagtggttcgcgggcgagctcaaggagccgcgcgac
gcggtggtcgcggagccggagatcggcctcgggccgctgcataccggcttcgacggcaag
ggctacgcgtacacgacgctctttctcgacagccagatcgtcaagtggagcctcgaggaa
gcgatcaaggcgtacaagggcgagaaggcggcgaaagtcgtcgtcgaccggatcgacgtg
cactaccagccgggccacggcttcacgtcgatgggcgagacgaaggagccggacggccag
ttcttcatctcggacaacaagttctcgaaggaccgctacctgcccgtcgggccgctgcat
ccggacagcgcgcagttgatcgacatcagcggcgagaagatgctgctcgtggccgaccat
ccgacgtatcccgagccgcacgactcgatcgtcgtgcgccgcgacatcatcaagacacgg
cagatctacaacctcgacgagttcccgctcgcggtgaagaacgcgaaggacagccgcgtc
gagcggcacggcaggaaggtcaccgtctacctgacgtcgcaggcgccgaccttcgggctg
cgcgaatggaccgtgaagaaaggcgacgaggtcacgatcatcctgaccaacctcgacaag
gtggaggacctgacgcacggcttcgcgatcccgttctacaacatcaacttcgtcgtgcat
ccgcagcagacgcagtcggtgacgttcatcgcggacaagcccggcgtgttctggtgcttc
tgcacgaacttctgccacgcgctgcatctggagatgcgctcgcggatgctcgtcgaggcg
tag

DBGET integrated database retrieval system