KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1789Help
Entry
BP1026B_I1789     CDS       T02049                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BP1026B_I1789
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     BP1026B_I1789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(1990214..1991188)
Genome map
AA seq 324 aa AA seqDB search
MTAAVERAAGGASPARAGRVMVVGSLNMDLVVRSARLPRPGETLAGRSFAQAAGGKGGNQ
AVAAARLGAQVAMLGRVGADAHGAALRAGLVAEGIDCVALSVSATATTGVALIVVDDASQ
NAIVIVAGSNGEVTPESIAGHEAAIAAADVLICQLETPAAAVRAALAAGRRLGKTVVLNP
APAAGPLPADWLPLVDYLIPNEIEAAALTGLPVRDPASAETAARALAAAGARNVIVTLGG
QGVLALTADGDARHYPAPRVAPVDTTAAGDTFIGGFAARLAARDAPHDAIRFAQRAAALS
VTRAGAQPSIPTLAELDAFAPGPA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgacggccgccgtcgaacgcgcggccggcggggcctcgcccgcgcgcgccggcagggtg
atggtggtcggcagcctgaacatggacctcgtcgtgcgctcggcgcggctgccgcggccg
ggcgagacgctcgccggccgctcgttcgcgcaggcggcgggcggcaagggcggcaaccag
gcggtcgcggccgcgcggctcggcgcgcaggtggcgatgctcggccgcgtcggcgcggac
gcgcacggcgccgcgctgcgcgcggggctcgtcgccgaggggatcgattgcgtcgcgctg
tcggtcagcgcgacggcgacgacgggcgtcgcgctcatcgtcgtcgacgatgcgagccag
aacgcgatcgtgatcgtcgcgggcagcaacggcgaggtgacccccgaatcgatcgccggg
cacgaggcggcgatcgccgcggccgacgtgctgatctgccagctcgagacgcccgccgcc
gcggttcgcgcggcgctggccgccggccgccggctcggcaagaccgtcgtgctgaatccg
gcgcccgctgccggcccgctgcccgccgactggttgccgctcgtcgattacctgatcccg
aacgaaatcgaggccgccgcgctgaccggcttgccggtgcgcgacccggcgagcgccgag
accgccgcgcgcgcgcttgcggcggctggcgcgcgcaacgtgatcgtcacgctgggcggc
cagggcgttctcgcgctgacggcggacggcgacgcgcgccactacccggcgccgcgcgtc
gcgcccgtcgacacgacggccgcgggggacacgttcatcggaggtttcgccgcgcggctc
gccgcgcgcgacgcgccgcacgacgcgatccggttcgcgcagcgcgcggctgcgttgtcg
gtcacgcgcgcgggcgcgcagccgtcgattccgacgctcgccgagctcgacgcgttcgcg
ccggggccggcgtga

DBGET integrated database retrieval system