KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1874Help
Entry
BP1026B_I1874     CDS       T02049                                 

Gene name
sucB
Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:bpz01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:bpz00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:bpz00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2077765..2079030)
Genome map
AA seq 421 aa AA seqDB search
MAIVEVKVPQLSESVSEATMLQWKKKPGEAVAQDEILIELETDKVVLEVPAPAAGVLAQV
LQNDGDTVVADQVIATIDTEAKAGAAAAAAGAADVQPAAAPVAAPAPAAQPAAAAASSTA
AASPAASKLMAEKGIGAGDVAGSGRDGRITKGDVLSAGSAPAAAPAKAAAKPALPEVKVP
ASATTWLNDRPEQRVPMSRLRARIAERLLESQQTNAILTTFNEVNMQPVMDLRAKYKDKF
EKEHGVKLGFMSFFVKAAVHALKKFPLVNASIDGNDIVYHGYFDIGIAVGSPRGLVVPIL
RNADQLSLAEIEKKIAEFGQKAKDGKLSIEEMTGGTFSISNGGVFGSMLSTPIINPPQSA
ILGVHATKERPVVENGQIVIRPINYLALSYDHRIIDGREAVLSLVAMKDALEDPARLLLD
L
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgtagaagtcaaagtcccccagctttcggagtcggtttcggaagcgaccatg
ctgcagtggaagaagaagcccggcgaagccgtcgcgcaggacgaaatcctgatcgagctc
gagacggacaaggtcgtcctcgaagtgccggcgccggccgcgggcgtgctcgcgcaggtg
ctgcagaacgacggtgacacggtcgtcgccgaccaggtgatcgcgaccatcgacaccgaa
gcgaaggcaggcgccgccgcggcagcggcaggcgccgccgacgttcagccggccgccgct
cccgtcgccgcgccggcgcccgccgcacagccggccgccgccgccgcgtcgagcaccgcg
gccgcatcgcccgccgcgtcgaagctgatggccgagaagggcatcggcgccggcgacgtc
gccggctcgggccgcgacggccgcatcacgaagggcgacgtgctgtccgcgggcagcgcg
ccggccgccgcgccggcgaaggccgccgcgaagccggcgctgccggaagtgaaggtgccg
gcatcggcgacgacgtggctcaacgaccgtccggagcagcgcgtgccgatgtcgcgcctg
cgcgcgcgcatcgccgagcgtctgctcgaatcgcagcagaccaacgcgatcctcacgacg
ttcaacgaagtgaacatgcagccggtgatggacctgcgcgcgaagtacaaggacaagttc
gagaaggagcacggcgtgaagctcggcttcatgtcgttcttcgtgaaggcagccgttcac
gcgctgaagaagttcccgctcgtgaacgcgtcgatcgacggcaacgacatcgtctaccac
ggctacttcgacatcggcatcgcggtcggttcgccgcgcggcctcgtcgtgccgatcctg
cgcaacgcggatcagctgagcctcgccgagatcgagaagaagatcgccgaattcggccag
aaggcaaaggacggcaagctgtcgatcgaggaaatgacgggcggcacgttctcgatctcg
aacggcggcgtgttcggctcgatgctgtcgacgccgatcatcaacccgccgcagtcggcg
atcctcggcgtgcacgcgacgaaggagcgcccggtcgtcgagaacggccagatcgtgatc
cgcccgatcaactatctcgcgctgtcgtacgaccaccggatcatcgacggtcgcgaagcg
gtgctgtcgctcgtcgcgatgaaggacgcgctcgaagatccggcgcgcctgctgctcgac
ctgtaa

DBGET integrated database retrieval system