KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1950Help
Entry
BP1026B_I1950     CDS       T02049                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BP1026B_I1950 (galU)
   00052 Galactose metabolism
    BP1026B_I1950 (galU)
   00500 Starch and sucrose metabolism
    BP1026B_I1950 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    BP1026B_I1950 (galU)
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BP1026B_I1950 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2166984..2167865
Genome map
AA seq 293 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAIAAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLDLVRSIKPSHVDCFYVRQPEALGLGHAVLCAEK
LVADNPFAVILADDLLDGDPPVMKQMVDVFDHYHSSVIGVEEIPPEDTKSYGIVDGKEWE
DSIIKMSAIVEKPAPEVAPSNLGVVGRYVLKPRIFDHLRALKPGAGGELQLTDAIQALLA
DEQVLAYKYRGTRFDCGSKLGYLKATVEFALRHPEVKTEFETYLRSRSETQHG
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaggcggttttcccggtcgcgggcctgggcacgcggtttctgccc
gccaccaaggcgagtccgaaggaaatgctgcccgtcgtcgacaaaccgttgatccagtat
gcggtggaagaagcgattgcagccggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaggaccatttcgacaagtcgtatgagatcgaagcggagctcgaggcg
cgcggcaaggaaaagctgctcgatctcgtgcgcagcatcaagccgagccacgtcgactgc
ttctacgtgcgccagccggaagcgctcggcctgggccacgcggtgctgtgcgcggagaag
ctcgtcgcggacaatccgttcgcggtgatcctcgccgacgacctgctcgacggcgatcca
cccgtgatgaagcagatggtggacgtgttcgaccactatcacagctcggtgatcggcgtc
gaggagatcccgcccgaggacacgaagtcgtacgggatcgtcgacggcaaggaatgggaa
gactcgatcatcaagatgtcggcgatcgtcgagaaacccgcgcccgaagtcgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctcaagccgcgcatcttcgatcacctgcgcgcg
ctcaagccgggcgcgggcggcgagctgcagttgaccgacgcgatccaggcgctcctcgcg
gacgaacaggtgctcgcatacaagtatcgcggcacccgcttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagttcgcgctgcgccaccccgaagtgaagaccgagttc
gaaacgtatctgcgctcgcgcagcgaaacgcaacacgggtaa

DBGET integrated database retrieval system