KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1984Help
Entry
BP1026B_I1984     CDS       T02049                                 

Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bpz00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bpz00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2208874..2210898)
Genome map
AA seq 674 aa AA seqDB search
MPVALAVAAALGACSGDDDATLESRADAIVERMTTRQKVGQKLMMAFRYWCPDGQPACTA
GMTEFPDAARDALRENGIGGVILFSNNLTGIEQTRRLIDGIRAAPAADSPLGLMIGIDEE
GGNVFRLPRVEATAFAGNMALGAAYEATRDDRLAYDMGRVLAAEIAAVGFNVNFAPDVDV
NSNPLNPVINVRAFGDDPATIGLLGRRMVQGMKSERVIGTFKHFPGHGDTDTDSHYGLPV
VIKSRADAYAIDLAPYRQAIEAGEAPDMIMTAHIQYPSLDDTRVATRTGEQMIAPATMSR
RIQHDILRGEFGYQGVTITDALDMKGIAGFFDEDDAVVKVFQADVDIALMPVEFRTAADA
GRLAALVDRVAAAVDSGRIDRAEFDRSVRRIVLTKLRHGIVASDRGRPVDELASIGGPAH
RAIERDIAQKSITVLRNENGALPLQAAGRRIFILTPWGEQAEAMRRRFVELGHPLVTGAK
LSAITWAEQQQAIDAADVVIVGTLSTGVTPVEHNGDPNARVSPPAPSAVRMRQAAPANGE
EEGSVIFDHVERADAAKDIGARPSVLAAIAAPSEAQQMRDAMDYAKARRKTVIHVTMRAP
YDVISYDDVADATLATYAYYGYEGGLRGPSLPAAVDAMLGVARPVGRLPVAIHALNADGS
TGPLRYARGFGLQY
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtcgcgctggcggtggccgcggcgctcggcgcgtgctcgggcgacgacgacgcg
acgctcgagtcgcgcgcggacgcgatcgtcgaacgcatgacgacccggcagaaggtcggc
caaaaactgatgatggcgttccggtactggtgccccgacgggcagcccgcgtgcacggcc
ggcatgaccgaatttcccgacgccgcgcgcgacgcgctgcgcgagaacggcattggcggc
gtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgccggctgatcgacggc
attcgggccgcgcccgcggccgacagcccgctcgggctgatgatcggcatcgacgaggag
ggcggcaacgtgtttcgcctgccgcgcgtcgaggcgaccgcgttcgccggcaacatggcg
ctcggcgcggcgtacgaagcgacgcgggacgaccggctcgcgtacgacatgggccgcgtg
ctcgccgcggagatcgcggcggtcggcttcaacgtgaatttcgcgccggacgtcgacgtc
aacagcaatccgctcaatccggtgatcaacgtgcgcgcgttcggcgacgatccggcgacg
atcggcctgctcggccggcgcatggtgcagggcatgaagagcgagcgcgtgatcggcacg
ttcaagcattttcccgggcacggcgacacggataccgattcgcactacggactgcccgtc
gtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccgtaccggcaggcgatc
gaagcgggcgaggcgcccgacatgatcatgaccgcgcacatccagtatccgtcgctcgac
gacacccgcgtcgcgacccgcacgggcgagcagatgatcgcgcccgcgacgatgtcgcgg
cgcatccagcacgatatcctgcgcggcgagttcggctatcagggcgtgacgatcaccgac
gcgctcgacatgaagggcatcgccggcttcttcgacgaggacgacgcggtcgtcaaggtg
ttccaggcggacgtcgacattgcgctgatgcccgtcgagtttcgcaccgcggccgatgcc
gggcgcctggcggcgctcgtcgatcgcgtcgccgcggcggtcgattcggggcggatcgat
cgcgccgagttcgatcgctcggtgcgccgtatcgtgctgacgaagttgcgccacggcatc
gtcgcgtcggatcgcggccggccggtcgacgagctggcatcgatcggcgggcccgcgcac
cgcgcgatcgagcgcgacatcgcgcaaaaatcgatcaccgtgctgcgcaacgagaacggc
gcgctgccgctgcaggccgcgggccggcgcatcttcatcctgacgccgtggggcgagcag
gccgaggcgatgcggcggcgtttcgtcgagcttggccatccgctcgtcacgggcgcgaag
ctgagcgcgatcacgtgggccgaacagcagcaggcgatcgatgcggccgacgtcgtgatc
gtcggcacgctgtcgacgggcgtcacccccgtcgagcacaacggggatccgaacgcgcgc
gtgagcccgccggcgccgtcggccgtgcggatgcggcaggccgcgcccgcgaacggcgag
gaggagggttcggtgatcttcgaccacgtcgagcgggcggacgcggcgaaggacatcggc
gcgcgcccgagcgtgctcgcggcgatcgcggcgccgagcgaggcgcagcagatgcgcgac
gcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtgacgatgcgcgcgccg
tacgacgtgatcagctacgacgatgtcgcggacgcgacgctcgccacctacgcgtactac
ggttacgaaggcggcttgcgcggcccgtcgctgcccgcggccgtcgacgcgatgctcggc
gtcgcgcggccggtcggcaggctgccggtcgcgatccacgcgctgaacgcggacggatcg
acggggccgctgcgctacgcgcgcggatttgggttgcagtactga

DBGET integrated database retrieval system