KEGG   Burkholderia pseudomallei 1026b: BP1026B_I1984Help
Entry
BP1026B_I1984     CDS       T02049                                 

Definition
Beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    BP1026B_I1984
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    BP1026B_I1984
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     BP1026B_I1984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2208874..2210898)
Genome map
AA seq 674 aa AA seqDB search
MPVALAVAAALGACSGDDDATLESRADAIVERMTTRQKVGQKLMMAFRYWCPDGQPACTA
GMTEFPDAARDALRENGIGGVILFSNNLTGIEQTRRLIDGIRAAPAADSPLGLMIGIDEE
GGNVFRLPRVEATAFAGNMALGAAYEATRDDRLAYDMGRVLAAEIAAVGFNVNFAPDVDV
NSNPLNPVINVRAFGDDPATIGLLGRRMVQGMKSERVIGTFKHFPGHGDTDTDSHYGLPV
VIKSRADAYAIDLAPYRQAIEAGEAPDMIMTAHIQYPSLDDTRVATRTGEQMIAPATMSR
RIQHDILRGEFGYQGVTITDALDMKGIAGFFDEDDAVVKVFQADVDIALMPVEFRTAADA
GRLAALVDRVAAAVDSGRIDRAEFDRSVRRIVLTKLRHGIVASDRGRPVDELASIGGPAH
RAIERDIAQKSITVLRNENGALPLQAAGRRIFILTPWGEQAEAMRRRFVELGHPLVTGAK
LSAITWAEQQQAIDAADVVIVGTLSTGVTPVEHNGDPNARVSPPAPSAVRMRQAAPANGE
EEGSVIFDHVERADAAKDIGARPSVLAAIAAPSEAQQMRDAMDYAKARRKTVIHVTMRAP
YDVISYDDVADATLATYAYYGYEGGLRGPSLPAAVDAMLGVARPVGRLPVAIHALNADGS
TGPLRYARGFGLQY
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgtcgcgctggcggtggccgcggcgctcggcgcgtgctcgggcgacgacgacgcg
acgctcgagtcgcgcgcggacgcgatcgtcgaacgcatgacgacccggcagaaggtcggc
caaaaactgatgatggcgttccggtactggtgccccgacgggcagcccgcgtgcacggcc
ggcatgaccgaatttcccgacgccgcgcgcgacgcgctgcgcgagaacggcattggcggc
gtgatcctgttctcgaacaacctgacgggcatcgagcagacgcgccggctgatcgacggc
attcgggccgcgcccgcggccgacagcccgctcgggctgatgatcggcatcgacgaggag
ggcggcaacgtgtttcgcctgccgcgcgtcgaggcgaccgcgttcgccggcaacatggcg
ctcggcgcggcgtacgaagcgacgcgggacgaccggctcgcgtacgacatgggccgcgtg
ctcgccgcggagatcgcggcggtcggcttcaacgtgaatttcgcgccggacgtcgacgtc
aacagcaatccgctcaatccggtgatcaacgtgcgcgcgttcggcgacgatccggcgacg
atcggcctgctcggccggcgcatggtgcagggcatgaagagcgagcgcgtgatcggcacg
ttcaagcattttcccgggcacggcgacacggataccgattcgcactacggactgcccgtc
gtgatcaagtcgcgcgccgacgcctacgcgatcgatctcgcgccgtaccggcaggcgatc
gaagcgggcgaggcgcccgacatgatcatgaccgcgcacatccagtatccgtcgctcgac
gacacccgcgtcgcgacccgcacgggcgagcagatgatcgcgcccgcgacgatgtcgcgg
cgcatccagcacgatatcctgcgcggcgagttcggctatcagggcgtgacgatcaccgac
gcgctcgacatgaagggcatcgccggcttcttcgacgaggacgacgcggtcgtcaaggtg
ttccaggcggacgtcgacattgcgctgatgcccgtcgagtttcgcaccgcggccgatgcc
gggcgcctggcggcgctcgtcgatcgcgtcgccgcggcggtcgattcggggcggatcgat
cgcgccgagttcgatcgctcggtgcgccgtatcgtgctgacgaagttgcgccacggcatc
gtcgcgtcggatcgcggccggccggtcgacgagctggcatcgatcggcgggcccgcgcac
cgcgcgatcgagcgcgacatcgcgcaaaaatcgatcaccgtgctgcgcaacgagaacggc
gcgctgccgctgcaggccgcgggccggcgcatcttcatcctgacgccgtggggcgagcag
gccgaggcgatgcggcggcgtttcgtcgagcttggccatccgctcgtcacgggcgcgaag
ctgagcgcgatcacgtgggccgaacagcagcaggcgatcgatgcggccgacgtcgtgatc
gtcggcacgctgtcgacgggcgtcacccccgtcgagcacaacggggatccgaacgcgcgc
gtgagcccgccggcgccgtcggccgtgcggatgcggcaggccgcgcccgcgaacggcgag
gaggagggttcggtgatcttcgaccacgtcgagcgggcggacgcggcgaaggacatcggc
gcgcgcccgagcgtgctcgcggcgatcgcggcgccgagcgaggcgcagcagatgcgcgac
gcgatggactacgcgaaggcgcggcgcaagaccgtgatccacgtgacgatgcgcgcgccg
tacgacgtgatcagctacgacgatgtcgcggacgcgacgctcgccacctacgcgtactac
ggttacgaaggcggcttgcgcggcccgtcgctgcccgcggccgtcgacgcgatgctcggc
gtcgcgcggccggtcggcaggctgccggtcgcgatccacgcgctgaacgcggacggatcg
acggggccgctgcgctacgcgcgcggatttgggttgcagtactga

DBGET integrated database retrieval system