KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2093Help
Entry
BP1026B_I2093     CDS       T02049                                 

Definition
Glycoside hydrolase family protein gp24
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
bpz  Burkholderia pseudomallei 1026b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2341184..2341675)
Genome map
AA seq 163 aa AA seqDB search
MAEKKTLIGVVGAATAALLLSIIPAFEGEVLVARPDPIGIVTACNGDTKDVYAGQRFTRD
ECRARLEQRLIEHAEPVLTCTPGLRGRTYQLAAAVSFAYNIGPRAYCGSTTARRFNAGDW
RGACRAINESDNGRPQWVTAGGRVLPGLVKRRATERAICERGL
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atggctgagaagaagacgctgattggagtggtaggggccgcgacagcggcccttttgctt
tctatcattcctgcatttgaaggtgaggtgcttgtcgcgcggccagatccaatcggcatc
gtcacggcatgcaacggcgatacgaaagacgtgtacgcgggccagcgcttcacgcgtgat
gaatgccgcgcgcggctcgagcaacggctcatcgagcacgcggagccggtcctgacgtgc
acgcccggcttgagggggcgcacatatcagctcgcggcggcggtgagcttcgcctacaac
atcgggccgcgcgcctactgcggcagcacaacggcgaggcggttcaatgcgggcgactgg
cggggcgcgtgtcgcgcgatcaacgagtcggacaacggtcggccgcagtgggtgactgct
ggcggtcgagtgctgccgggtctcgtgaaacgccgcgctactgaacgcgcaatttgtgag
cgggggctgtga

DBGET integrated database retrieval system