KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2181Help
Entry
BP1026B_I2181     CDS       T02049                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    BP1026B_I2181 (folP)
Enzymes [BR:bpz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     BP1026B_I2181 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(2407229..2408035)
Genome map
AA seq 268 aa AA seqDB search
MGILNVTPDSFSDGGRYVARDAALAQAERMLAEGADILDIGGESTRPGAPPVPLNEELER
VIPLVEALRGRNVPLSIDTYKPAVMRASLAAGADLINDIWGLRQPGAIDAVRDSACGLCV
MHMLGEPRTMQVHAPEYRDVIDDVRAFLAERADALVQAGIDARRISVDPGFGFGKSVIEH
NYALLAHLPRTAPARPDGRAYPILAGMSRKSMLGAVIGRPAPERIAASVAAAVCAAERGA
AIVRVHDVAATVDALKVWSAVRDAARRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggggatcctcaacgtcacccccgattcgttctccgacggcggccgttacgtcgcccgt
gacgccgcgctcgcgcaggcggagcggatgcttgccgaaggcgcggacatcctcgacatc
ggcggcgaatcgacgcgccccggcgcgccgcccgtgccgcttaacgaggagctcgagcgc
gtgattccgctcgtcgaggcgctgcgcggccggaacgtgccgctgtcgatcgacacgtac
aagcccgccgtgatgcgcgcgtcgctcgccgcgggcgccgatctgatcaacgatatctgg
gggctgcggcagccgggcgcgatcgacgcggtgcgcgacagtgcgtgcggcctctgcgtg
atgcacatgctcggcgagccgcggacgatgcaggtgcatgcgcccgagtatcgcgacgtg
atcgacgacgtgcgcgcgtttctcgccgagcgcgccgatgcgctcgtgcaggcgggcatc
gatgcccgacgtatcagcgtcgatccggggttcggtttcggcaagtcggtgatagaacac
aactatgcgctgcttgcgcatttgccgaggaccgcgcccgcgcggcccgacgggcgcgcg
tatccgatcctcgccggcatgtcgcgcaagtcgatgctgggcgcggtgatcggcagaccc
gcgccggagcgcatcgcggcgagcgtcgcggcggcggtctgcgcggccgagcggggggcg
gcgatcgtgcgcgtgcacgacgtcgcggcgaccgtcgacgcattgaaagtatggagcgcc
gtgcgcgatgccgcgcggcgagcataa

DBGET integrated database retrieval system