KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2262Help
Entry
BP1026B_I2262     CDS       T02049                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BP1026B_I2262
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BP1026B_I2262
DNA repair and recombination proteins [BR:bpz03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     BP1026B_I2262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 AAA_11 Helicase_RecD Viral_helicase1 UvrD-helicase DUF2075 MukB UvrD_C AAA_29 CbiA
Motif
Other DBs
NCBI-ProteinID: AFI66869
UniProt: A0A0H3HKM3
Position
1:complement(2496898..2499588)
Genome map
AA seq 896 aa AA seqDB search
MVDERFAWTGGLADRLPEPADFGLALAEGFARRIGMLSRRVGASAAAARWAARAAFAASR
ATAAGHVCVALRALAQRYDEPYDDVRAALAASGVTAFDGIVRGGECPLVVDRDGRLYLAR
YFEYETRLANALVERSRCGGAPACGADALSPDALGERLVRYFGPQKERGVDWQRVAALIA
LTGRVTIVSGGPGTGKTTTVVGVIACLLDAHPELRIALAAPTGKAAQRMQEALHARAGSL
PAELAARLPRTSCTLHRLLGGGPGGRFAHHRDNPLPYDLVVVDEASMIDVALAAHLLDAL
APNARLVLLGDKDQLAAVEAGAVFAELSARPAFSPATCATIARALGVGEAEFVAALPDGF
VVQAVGAERVADARAAAADMDVAARGTAGAAAAAARATAAAAARMTTAAAAARGGAPESA
AQRAPAPHAGRRGGGRASNRTVDDAQGSLFAFDDDAFGVGTSGGEPGAGAQGAGRRDGGA
PSLDEPHAGRRDGGASPGVAHSRRDAFDARARSGPADVSDLENAARAYAPAGAAGPADSP
ADASFVEPAAWIEADELAWLDNAVFSFSEGASANAEADGRRSAAATATDAGARTAPPVAR
EATAPTPRETARSDGSAVAPLTDCVVWLERNYRFGLDSPIGRLSLAIRRGAVQDALDALS
TQDDAAARFSDDGGATLSAATVEQLARGFAGYAAALRDALATPEPDALPLFDVLNRFRVL
CATRTGARGAEEVNARMAAEVRRAVRVPLALGAHWFAGRPVMVTRNDYALGLFNGDIGIA
LPGARGALRVWFRGADGRARAVSPAALPPHDTAFALTVHKSQGSEFDDAALILPASFNRV
LSRELVYTAITRARARVQVIGSRAVLALAIATRTARDSGLAARIADALRARQEGAR
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
gtggtcgacgaacgtttcgcgtggacgggcggcctggcggaccgtctgcccgagccggcc
gatttcgggctcgcgctcgccgaaggcttcgcgcgccggatcgggatgctgtcgcggcgt
gtcggcgcgagcgccgcggccgcgcgctgggcggcacgcgcggcgttcgccgcgagccgc
gcgacggcggcggggcacgtatgcgtcgcgctgcgcgcgctcgcgcagcgctacgacgag
ccgtacgacgacgtacgcgcggcgctcgccgcgagcggcgtgaccgcgttcgacggcatc
gtgcgcggcggcgagtgcccactcgtcgtcgatcgcgatggtcggctgtatctcgcgcgc
tacttcgaatacgagacgcggctcgcgaacgcgctcgtcgagcggagccgatgcggcggc
gcgccggcgtgcggcgccgatgcgctctcgcccgacgcgctcggcgagcggctcgtccgc
tatttcgggccgcagaaggagcggggcgtcgattggcagcgcgttgcggcgctcatcgcg
ctcacgggccgcgtgacgatcgtgagcggcgggccgggcaccggcaagacgacgacggtc
gtcggcgtgatcgcgtgcctgctcgatgcgcatccggagttgcggatcgcgcttgccgcg
cccaccggcaaggccgcgcagcggatgcaggaggcgctgcacgcgcgcgccggcagcctg
ccggcggaactcgcggcgcgcctgccgcgcacgtcctgcacgctgcaccggctgctgggc
ggtggcccgggcgggcgcttcgcgcaccaccgcgacaatccgctgccgtacgatctcgtc
gtcgtcgacgaggcttcgatgatcgacgtcgcgctcgccgcgcatttgctcgacgcgctc
gcgccgaacgcgcgcctcgtgctgctcggcgacaaggatcagctcgcggccgtcgaggcg
ggcgcggtgttcgccgagctgagcgcgcgtcccgcgttcagcccggcgacgtgcgcgacg
atcgcgcgcgcgctcggcgtcggcgaggccgagttcgtggcggcgctgccggacgggttc
gtcgtgcaggcggtcggcgcggagcgcgtggcggacgcgcgtgcggcggcggccgatatg
gacgtggccgcgcgcgggacggccggcgccgcggctgcggccgcacgagcgaccgcggcc
gcagccgcacgaatgaccacggccgcagccgcggcgagggggggcgcgccggaatccgcc
gcgcaacgcgcgccggcgccgcacgcgggccggcgcggcggcgggcgcgcatcgaatcgg
accgtcgacgatgcgcagggatcgttgttcgcgttcgacgacgacgcattcggtgtgggc
acgtcgggcggcgagccgggggccggcgcgcaaggtgccgggaggcgagatggcggggcg
ccgagcctcgacgagccgcacgccgggcgccgggacggcggcgcatcgcccggcgtcgcg
cacagccggcgcgatgcgttcgacgcgcgtgcccggtcgggtccggcggatgtttccgac
ctggaaaacgccgcgcgcgcgtacgcgccggcgggcgcagccggcccggccgattcgccg
gcggacgcgtctttcgtcgagccggccgcgtggatcgaagcggacgaactcgcgtggctc
gacaacgcggtcttttcgttctccgaaggcgcttcggcgaatgccgaagccgacgggcgg
cgaagcgccgcggcgacggcgaccgacgcgggcgcgcgcaccgcgccgccggttgcgcgg
gaagcgacggcgccgacgccgcgcgagaccgcgcgatcggacggttccgccgtcgcgccg
ctgaccgactgcgtcgtctggcttgaacgcaactatcgcttcggccttgattcgccgatc
ggccggctgtcgcttgcgattcgccgcggcgcggtgcaggacgcgctcgacgcgctatcg
acgcaagacgacgcggccgcgcgttttagcgacgacggcggtgcgacgctatcggccgcg
acggtcgagcagctcgcgcgaggcttcgccggctatgcggccgcgctgcgcgacgcgctg
gcgacgcccgagcccgatgcgctgccgctcttcgacgtgctcaaccgctttcgcgtgctt
tgcgcgacgcgcacgggcgcgcgcggcgcggaggaagtcaacgcgcgcatggcggccgag
gtgcgccgcgcggtgcgcgtgccgctcgcgctcggtgcgcactggttcgccggacggccc
gtgatggtgacgcgcaacgattacgcgctcggcctcttcaacggcgacatcggcattgcg
ctgcccggcgcgcgcggtgcgctgcgcgtctggtttcgcggcgcggacggccgcgcccgg
gcggtgtcgcccgccgcgctgccgccgcacgacacggcgttcgcgctgaccgtccacaaa
tcgcagggctcggaattcgacgacgcggcactgatcctgcccgcgtcgttcaatcgcgtg
ctgtcgcgcgaactcgtctacaccgcgatcacgcgcgcgcgcgcgcgcgtgcaggtgatc
ggctcgcgcgcggtgctcgcgctcgcgatcgcgacgcgcacggcgcgcgattccggcctt
gccgcacgaatcgccgatgcgctgcgcgcgcggcaggagggcgcgcgatga

DBGET integrated database retrieval system