KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2523Help
Entry
BP1026B_I2523     CDS       T02049                                 

Gene name
hemD
Definition
(GenBank) bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase
  KO
K13543  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00860  Porphyrin and chlorophyll metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
Module
bpz_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BP1026B_I2523 (hemD)
Enzymes [BR:bpz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     BP1026B_I2523 (hemD)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     BP1026B_I2523 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HemX HEM4 Jnk-SapK_ap_N FimP TEX13 FadA Noelin-1
Motif
Other DBs
NCBI-ProteinID: AFI67119
UniProt: A0A0H3HLA3
Position
1:complement(2804605..2806584)
Genome map
AA seq 659 aa AA seqDB search
MAGAPRTFTAVLTRPDGQSAALAAQLAAAGIDVLDFPLIDIAPLADDAPLAEAFARLDAY
ALVVFVSPNAVDHALARLGAIWPHPLPIGVVGPGSVAALARHGIAAPAHRVIAPSAPDDG
GEPHYDSESLFAEIARAFNGEAKLAGKRVLIVRGDGGREWLAERLREAGAEVELVAAYRR
VSPEPSIGAWERVHALLSGAPHAWLVTSSEGVRNLQELAHEHLNETEIDALKHARFVAPH
SRIVETARALGFDRITLTGAGDERIVRAFRTLADQADQPATAAPMPSRMTDTNDTKDVSS
KPAAAPVAPPNQPFTPFETKERRGAASAALWFVVVVIAAAAGVGGYALNRKVDRLDQHAT
ERQKALDAQTAELRTKTEQALASVRQADSQLSQLEGKLADAQTAQTALQQQYQDLSRNRD
AWMIEEVGQMLSSASQQLLLTGNTQLALIALQNADARLASSQSAQAVVVRKAIAQDIERL
KAAPSADLTGLAIKLDDAIAKVDTLPLAGEVLAPHAQAKPDAAASARQAAAAAGEPRWKA
WWRGFSAGIGEQLKSLVEVRRIDHADAMLASPEQGYFVRENVKLRLLSARLSLLARDDGA
MKSDLHAAQAAVARYFDGASKDTRVVQDLLKQVDAASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgcgccgcgcacgttcaccgcggtgctcacgcgccccgacggacagtcggcg
gcgctcgcggcgcagctcgcggcggcgggcatcgacgtgctcgactttccgctcatcgac
atcgcgccgctcgccgacgacgcgccgctcgccgaagcgttcgcgcggctcgacgcgtat
gcgctcgtcgtgttcgtgtcgccgaacgcggtcgatcacgcgctcgcgcggctcggcgcg
atctggccgcatccgctgccgatcggcgtcgtcgggccgggcagcgtcgccgcgctcgcg
cggcacggcatcgccgcgcccgcgcatcgcgtgatcgcgccgagcgcgcccgacgacggc
ggcgagccgcactacgattccgagagcctgttcgccgagatcgcgcgtgcgttcaacggc
gaggcgaagctcgccggcaagcgcgtgctgatcgtgcgcggcgacggcggccgcgaatgg
cttgccgagcgcctgcgcgaggcgggcgccgaagtcgagctcgtcgccgcgtatcggcgc
gtgagcccggagccttcgatcggcgcgtgggagcgcgtgcacgcgctgctgtcgggcgcg
ccgcacgcgtggctcgtgacgagctcggagggcgtgcgcaatctgcaggagctcgcgcac
gagcatttgaacgaaacggagatcgacgcgctcaagcacgcccggttcgtcgcgccgcat
tcgaggatcgtcgagaccgcgcgcgcactcggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgtacgttggccgatcaggccgatcaaccggcg
acagccgcaccgatgccttctcgcatgacagacaccaacgataccaaagacgtctcttcc
aaaccggccgcggctcccgttgcgccgccgaatcaaccgtttacgccgtttgaaacgaag
gagcggcgcggcgcggcgagcgcggcgctctggttcgtggtcgtcgtgatcgcggccgcg
gcgggcgtcggcggctatgcgctgaaccgcaaggtcgaccgcctcgatcagcacgcgacc
gagcggcaaaaggcgctcgacgcgcaaacggccgagctccgcacgaagaccgaacaggcg
ctcgcgagcgtgcgccaggccgattcgcaactgtcgcagctcgaaggcaagctcgccgac
gcgcagaccgcgcagaccgcgctgcagcagcaatatcaggatctgtcgcgcaaccgcgac
gcgtggatgatcgaggaagtcggtcagatgctgtcgagcgcgagccagcaactgctgctc
acgggcaacacgcagctcgcgctgatcgcgctgcagaacgccgatgcgcggctcgcgtcg
tcgcagagcgcgcaggcggtcgtcgtgcgcaaggcgatcgcgcaggatatcgaacggttg
aaggccgcgccttcggcggatctcacggggcttgcgatcaagctcgacgacgcgatcgcg
aaggtcgacacgttgccgctcgcgggcgaagtgctcgcgccgcacgcgcaggcgaagccc
gacgccgccgcgagcgcccggcaggcggccgcggcggcgggcgagccgcgctggaaggcc
tggtggcgcggcttctcggcgggcatcggcgagcaactgaagtcgctcgtcgaggtgcgc
cgcatcgatcacgcggacgcgatgctcgcgtcgcccgaacagggctacttcgtgcgcgag
aacgtgaagctgcgtctgctgagcgcgcggctgtcgctgctcgcgcgcgacgacggcgcg
atgaagtccgatctgcatgccgcgcaggcggccgtggcgcgctacttcgacggcgcatcg
aaggacacccgggtcgttcaggatctgctcaagcaggtcgacgccgcgtcgctgacggtc
gcggtgccgaacctcaatacgagcctgaacgcggttcaacagttcaagagccggggttga

DBGET integrated database retrieval system