KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2602Help
Entry
BP1026B_I2602     CDS       T02049                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bpz00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:2891069..2891908
Genome map
AA seq 279 aa AA seqDB search
MCRSDAPRTPYIRSRHGGGMVDTLKMGKAELVALAQRRLDNEIKDSGWSAREKLALTCRI
LFDDGHDSGLAGQITCRADAPHTYYTQRLGLGFDEIAESNLLQVDQDLEVIGGQGIPNPA
NRFHTWIYRARPDVNCIIHTHPTHVAALSMLETPLVVSHMDTCPLHGDCAFLKDWPGVPV
GNEEGEIISNALGDKRAILLSHHGQLVVGKTIEEACMLAILIERAARLQLLAMAAGAIAP
IPPALAADAHDWISTPKRDAVTFAYYARRALRRHPDCLD
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgtgtcgcagcgacgcaccaagaacaccgtacattcgttcacgtcatggaggcggtatg
gtcgacacattgaagatgggcaaggccgagctcgtcgcgctcgcgcagcggcggctcgac
aacgagatcaaggacagcgggtggagcgcgcgcgagaagctcgcgctcacctgccggatc
ctgttcgacgacgggcacgactccggcctcgccgggcagatcacgtgccgcgccgacgcg
ccgcacacgtactacacgcagcgcctcgggctcggcttcgacgagatcgccgaatcgaac
ctgctgcaggtcgatcaggacctcgaggtcatcggcggccagggcattccgaatcccgcg
aaccgctttcacacgtggatttatcgcgcgcgccccgacgtcaactgcatcatccacacg
cacccgacgcacgtcgccgcgctgtcgatgctcgagacgccgctcgtcgtgtcgcacatg
gacacctgtccgcttcacggcgactgcgcgttcctgaaggattggccgggcgtgcccgtc
ggcaacgaggaaggcgagatcatctcgaacgcgctcggcgacaagcgcgcgatcctgctg
tcgcatcacggccagctcgtcgtcggcaagacaatcgaagaggcgtgcatgctcgcgatc
ctgatcgagcgcgcggcgcggctgcaactgctcgcgatggcggccggcgcgatcgcgccg
attccgcccgcgctcgcggccgacgcgcacgactggatctcgacgcccaagcgcgacgcg
gtgaccttcgcgtactacgcgcgccgcgcgctacgccgccaccccgactgcctcgactga

DBGET integrated database retrieval system