KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2771Help
Entry
BP1026B_I2771     CDS       T02049                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00020  Citrate cycle (TCA cycle)
bpz00640  Propanoate metabolism
bpz00660  C5-Branched dibasic acid metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01200  Carbon metabolism
Module
bpz_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bpz_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    BP1026B_I2771 (sucC)
   00640 Propanoate metabolism
    BP1026B_I2771 (sucC)
   00660 C5-Branched dibasic acid metabolism
    BP1026B_I2771 (sucC)
Enzymes [BR:bpz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     BP1026B_I2771 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 CPSase_L_D2 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: AFI67359
UniProt: A0A0H3HM21
Position
1:complement(3074833..3075999)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAQELGGPVWVVKAQIHAGGRGKGGGV
KVAKSLEQVREYSNQILGMQLKTHQTGPEGQKVNRLLIEEGADIKKELYVGIVIDRVSQK
VVVMASSEGGMDIEEVAEKTPEAIHKVAVEPSVGLQDAEADDLAKKIGVPDASIPQAREI
LKGLYKSFWETDASLAEINPLVLTGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPGLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LAESGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggtggacgaggccgtcaaggtggcgcaagagctgggcggc
ccggtctgggtcgtcaaggcccagattcatgcgggcggccgcggcaagggcggcggcgtg
aaggtcgcgaagtcgctcgagcaagtgcgcgaatactcgaaccagatcctcggcatgcag
ctgaagacgcaccagacgggcccggaaggccagaaggtcaaccgtctgctgatcgaagaa
ggcgcggacatcaagaaggaactgtatgtcggcatcgtgatcgatcgcgtgtcgcagaag
gtcgtcgtgatggcgtcgagcgaaggcggcatggacatcgaggaagtcgcggaaaagacg
ccggaagcgatccacaaggtcgccgtcgagccatcggtgggcctgcaggatgccgaagcc
gacgatctcgcgaagaagatcggcgtgccggacgcatcgatcccgcaagcgcgcgaaatc
ctgaagggcctgtacaagtcgttctgggaaacggacgcgtcgctcgccgaaatcaacccg
ctcgtgctgacgggcgacggcaaggtgatcgcgctcgacgcgaagttcaacttcgattcg
aacgcgctgttccgccatccggaaatcgtcgcgtaccgcgatctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcgggcctggcgatggcgacgatggatacgatcaagctgttcggc
ggcgagccggcgaacttcctcgacgtcggcggcggcgcaacgaccgagaaggtcaccgaa
gcgttcaagctgatgctgaagaacccgggcctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgcgggctcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaagacctcggcaagaagatg
cttgcggaatccggcctgccgatcatctcggcggacagcatggaagaagcggcgcagaag
gtcgtcgccgcggctgcgggcaagtaa

DBGET integrated database retrieval system