KEGG   Burkholderia pseudomallei 1026b: BP1026B_I2836Help
Entry
BP1026B_I2836     CDS       T02049                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    BP1026B_I2836 (glpK)
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BP1026B_I2836 (glpK)
Exosome [BR:bpz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP1026B_I2836 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3158574..3160130
Genome map
AA seq 518 aa AA seqDB search
MRRARGANHNYVRMEMRQMQDQYILALDQGTTSSRAMLFDRQGNIVSIAQKEFEQIYPQP
GWVEHDPQEIWSTQAGVAAEAVTRVGLNGTAIAAIGITNQRETTIVWDRETGHPIYNAIV
WQDRRTADFCDKLKAQGLSEKVRAKTGLPIDSYFSATKIRWILDNVEGAREKARQGKLAF
GTVDSWLVWNFTKHELHVTDVTNASRTMLFNIHTLDWDDELLDALEIPRSMLPQVRASSE
IYGPTKTTVFASKIPLAGIAGDQQAALFGQMCTSSGMVKNTYGTGCFLMMNTGETPIESR
NNLVTTIAWQVDGKVSYALEGSIFIAGAVVQWLRDGLGIIKSASEIEALAAGVPHTDGVY
LVPAFAGLGAPHWNARARGSLFGVTRGTTSAHLARAALDSIAYQSLDVLKAMEADSGIRI
GELRVDGGASANNLLMQFQADLLGVDAVRPRITETTALGAAYLAGLAIGYWQNVDELHSQ
WQLERRFAPSMQAEQVDSCLAGWQRAVRAAKAWADDTQ
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcccgcggcgccaatcacaactacgtacggatggagatgagacagatgcag
gatcagtacatcctcgcgctcgaccagggcacgaccagctcccgcgccatgctgttcgat
cgacaaggcaacatcgtatcgatcgcgcagaaggaattcgaacaaatttatccgcagccg
ggctgggtcgagcacgatccccaggagatctggtcgacgcaggcgggcgtcgcggccgag
gccgtcacgcgcgtcggcctgaacggcacggcgatcgccgcgatcggcatcacgaaccag
cgcgagacgacgatcgtctgggatcgcgagacgggtcatccgatctacaacgcgatcgtc
tggcaggatcgccgcaccgccgatttctgcgacaagctcaaggcgcagggcctcagcgag
aaggtgcgcgcgaagacgggcctgccgatcgactcgtacttctcggccaccaagatccgc
tggattctcgacaacgtcgagggcgcgcgcgagaaggcgcgccagggcaagctcgcgttc
ggcacggtcgacagctggctcgtgtggaacttcacgaagcacgagctgcacgtgaccgac
gtgacgaacgcgtcgcgcacgatgctcttcaacatccacacgctcgactgggacgacgag
ttgctcgacgcactcgagattccgcgcagcatgctgccgcaagtgcgcgcgtcctccgag
atctacgggccgacgaagaccaccgtgttcgcctcgaagattccgctcgccggcatcgcg
ggcgatcagcaggccgcgctcttcggccagatgtgcacgagctcgggcatggtgaagaac
acctacggcaccggctgcttcctgatgatgaacaccggcgagacgccgatcgaatcgcgg
aacaacctcgtcacgacgatcgcctggcaagtcgacggcaaggtcagctacgcgctcgaa
ggcagcatcttcatcgcgggcgcggtcgtgcagtggctgcgcgacgggctcggcatcatc
aagagcgcgtcggagatcgaggcgctcgccgccggcgtgccgcacacggacggcgtctat
ctcgtgcccgcgttcgccggcctcggcgcgccgcactggaacgcgcgcgcccgcggctcg
ctgttcggcgtcacgcgcggcacgacgtccgcgcacctcgcgcgcgcggcgctcgattcg
atcgcgtatcaatcgctcgacgtgctcaaggccatggaggccgattcgggcatccgcatc
ggcgagctgcgcgtggacggcggcgcgagcgcgaacaacctgctgatgcagttccaggcg
gatctgctcggcgtcgacgcggtgcgcccgcgcatcaccgagacgaccgcgctcggcgcc
gcgtatctcgcgggcctcgcgatcggctactggcagaacgtcgacgagctgcacagccaa
tggcagctcgagcgccgcttcgcgccttcgatgcaggccgagcaggtggactcttgcctc
gccggctggcagcgcgcggtgcgcgcggcgaaggcatgggcggacgacacgcagtaa

DBGET integrated database retrieval system