KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3063Help
Entry
BP1026B_I3063     CDS       T02049                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP1026B_I3063 (gpmA)
   01230 Biosynthesis of amino acids
    BP1026B_I3063 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_I3063 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    BP1026B_I3063 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BP1026B_I3063 (gpmA)
Enzymes [BR:bpz01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BP1026B_I3063 (gpmA)
Exosome [BR:bpz04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BP1026B_I3063 (gpmA)
  Exosomal proteins of melanoma cells
   BP1026B_I3063 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Structure
PDB: 

Jmol
Position
1:3415942..3416691
Genome map
AA seq 249 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGNREARQAGQLLKEAGYTFDIAYTSVLKR
AIRTLWHVQDQMDLMYVPVVHSWRLNERHYGALSGLNKAETAAKYGDEQVLVWRRSYDTP
PPALEPGDERAPYADPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVKAGKQVLIA
AHGNSLRALIKYLDGISDADIVGLNIPNGVPLVYELDESLTPIRHYYLGDQEAIAKAQAA
VAQQGKSAA
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgtacaagctcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgatgtcgacctgaccgaacaaggcaaccgcgaagcccggcaggcgggc
cagctcttgaaggaagccggctacacgttcgatatcgcatacacgtcggtgctcaagcgc
gcgatccgcacgctctggcacgtgcaggaccagatggatctgatgtacgtgcccgtcgtg
cattcgtggcgcctgaacgagcgccattacggcgcgctgtcgggcctgaacaaggcggag
acggccgcgaagtacggcgacgagcaggtgctcgtctggcgccgcagctacgacacgccg
ccgcccgcgctcgagccgggcgacgagcgcgcgccgtacgccgatccgcgctacgcgaag
gtgccgcgcgagcagttgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctctggaacgaatcgatcgcgcccgcggtgaaggccggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtatctcgacggcatctccgacgcggac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtctacgagctcgacgagagcctc
acgcccatccggcactactacctcggcgatcaggaggcgatcgcgaaggcgcaggccgcc
gtcgcgcagcagggcaagtccgcggcgtaa

DBGET integrated database retrieval system