KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3146Help
Entry
BP1026B_I3146     CDS       T02049                                 

Definition
alkaline phosphatase family protein subfamily
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bpz00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bpz00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:bpz02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:complement(3511441..3512970)
Genome map
AA seq 509 aa AA seqDB search
MLSIQFTFASHRPRIVLAFLKEITPTGSRNMKRVRLAALLGASVFAAAGCGSDEPKTPGA
SDNGAQTGAARNVIFFLGDGMGMTTLTAARIYALGEDGALTLDTLPETAFVKTYSNDAQV
TDSAPSMSAYMTGVKTNNEVISMTPDTKAIEPSASLTGNCGANNGKPVPTLLEIAKAKGL
ATGVVTTTRVTHATPAATYAHVCHRDAENDIAAQLVPGGAGYNAALGGGVDVVLGGGAQF
FVPKEAGGKRADGRHLVNELKAKGYAIAQNRDELLAADATKRGKLAGLFASSHMSYDLDR
GATKEPSLADMATRALDVLQKNPNGYFLMVEGGRIDHALHDTNAKRALQDTVAFDNAIKA
TLDKVRQTDPELKNTLVVVTADHDHTLVLNGYAARTGKTEAGKPGVLGVLRNYQTGAVAK
DADGAPYTIIGFGNGENRVQGSRAGTSLTDAVTGADDYRQEAVVRMAKGGETHGGTDVFL
GAIGRGADGFHGVIENNKVFELVRGAAQL
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctttcaattcaattcacattcgcgtcacatcgcccccgtatcgtcctggcgtttttg
aaagaaatcacaccaacgggaagccgaaacatgaagcgagtgagactggccgcgctcctt
ggcgcgagcgtcttcgcggcggcgggctgcggcagcgacgagccgaagacgccgggcgca
tcggacaacggcgcgcaaacgggcgccgcgcgcaacgtcatcttctttctgggcgacgga
atggggatgacgacgctcacggccgcgcgaatctatgcgctcggcgaggacggcgcgctc
acgctcgacacgctgcccgagaccgcgttcgtgaagacctattcgaacgatgcgcaggtg
acggacagcgcgccgtcgatgtccgcatatatgacgggcgtgaagacgaacaacgaagtg
atctcgatgacacccgacacgaaggcgatcgagccgagcgcgagtctcaccggcaactgc
ggcgcgaacaacggcaagccggtgccgacgctgctcgagatcgcgaaggcgaaggggctc
gccaccggcgtcgtgacgacgacccgcgtcacccacgcgacgcccgccgcgacctacgcg
cacgtgtgccaccgcgacgccgagaacgacatcgccgcgcagctcgtgccgggcggcgcg
ggctacaacgcggcgctcggcggcggcgtggatgtcgtgctgggcggcggcgcgcaattc
ttcgtgccgaaggaagcgggcggcaagcgcgcggacggccgccatctcgtgaacgagctg
aaggcgaagggctacgcgatcgcgcagaaccgcgacgagctcctcgccgccgatgcgacg
aagcgcggcaagctcgcgggcctgttcgcgtcgagccacatgagctacgacctcgaccgc
ggcgcgacgaaagagccgagcctcgccgacatggcgacgcgcgcgctcgacgtgctgcag
aagaacccgaacggctatttcctgatggtcgaaggcgggcgcatcgatcacgcgctgcac
gacacgaacgcgaagcgcgcgctgcaggatacggtcgcgttcgacaacgcgatcaaggcg
acgctcgacaaggtgcgccagaccgatccggagctgaagaacacgctcgtcgtcgtgacg
gccgaccacgatcacacgctggtgctcaacggctacgcggcgcgcacgggcaagacggaa
gcgggcaagccgggcgtgctcggcgtgctgcgcaactatcagacgggcgcggtcgcgaag
gacgcggacggcgcgccgtacacgatcatcggcttcggcaacggcgagaaccgcgtgcaa
ggcagccgcgcgggcacgagcctcaccgacgcggtgacgggcgcggacgattatcgccag
gaagcggtcgtgcgcatggccaagggcggcgagacgcacggcggcaccgacgtgttcctc
ggcgcgatcggccgcggcgcggacggctttcacggcgtgatcgagaacaacaaggtgttc
gagctcgtgcgcggcgcggcgcagctctga

DBGET integrated database retrieval system