KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3413Help
Entry
BP1026B_I3413     CDS       T02049                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bpz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3792071..3793036
Genome map
AA seq 321 aa AA seqDB search
MRRDDFSRRLMRENILTTNDLIYPVFVVEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVE
LGVPVLSLFPAIEPSLKTPDGREAANPEGLIPRAVRELKRRFPELGVLTDVALDPYTSHG
QDGVLDEAGYVLNDETLEILVEQARAQAEAGVDIVAPSDMMDGRIGAVREMLEREGHIYT
RIMAYSAKYASAFYGPFRDAVGSASNLGKGNKMTYQMDPANSDEALREVRLDIDEGADMV
MVKPGMPYLDIVRRVKDEFRYPTYVYQVSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRA
GADGILTYFALDAARLLRAQK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgacgatttctcgcgacgcctgatgcgcgaaaatatcctcaccacgaacgat
ctgatctacccggtgttcgtcgtcgaaggcacgaacgtgcgccagccggtgccgtcgatg
ccgggcgtcgagcgcgtgtcgatcgatctgctgatgggtgtcgccgagcaatgcgtcgag
ctcggcgtgccggtcctgtcgctctttccggccatcgagccgtcgctgaagacgcccgac
ggccgcgaagcggccaatcccgaagggctgatcccgcgtgcggtacgcgagctgaagcgc
cgcttccccgaactcggcgtgctgaccgacgtcgcgctcgatccgtacacgagccacggc
caggacggcgtgctcgacgaggccggctatgtgctcaacgacgaaacgctcgagattctc
gtcgagcaggcgcgcgcgcaggccgaagcgggcgtcgacatcgtcgcgccgtcggacatg
atggacgggcgcatcggcgcggtgcgcgagatgctcgagcgtgaaggccacatctacacg
cggatcatggcctactcggcgaagtacgcgtcggcgttctacggcccgttccgcgacgcg
gtcggctccgcgtcgaatctcggcaagggcaacaagatgacctaccagatggaccccgcg
aacagcgacgaggcgctgcgcgaagtgcgcctcgacatcgacgagggcgcggacatggtc
atggtgaagcccggcatgccgtatctcgacatcgtgcgccgcgtgaaggacgaattccgc
tatccgacctacgtctatcaggtgagcggcgaatacgcgatgctgaaggccgccgcgcag
aacggctggctcgatcacgacaaagtcgtgctcgaatcgctgctcgcgttcaagcgcgcg
ggcgcggacggcattctcacgtacttcgcgctcgacgcggcgcggctgctgcgcgcgcag
aagtaa

DBGET integrated database retrieval system