KEGG   Burkholderia pseudomallei 1026b: BP1026B_I3413Help
Entry
BP1026B_I3413     CDS       T02049                                 

Gene name
hemB
Definition
delta-aminolevulinic acid dehydratase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    BP1026B_I3413 (hemB)
Enzymes [BR:bpz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     BP1026B_I3413 (hemB)
Exosome [BR:bpz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BP1026B_I3413 (hemB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1:3792071..3793036
Genome map
AA seq 321 aa AA seqDB search
MRRDDFSRRLMRENILTTNDLIYPVFVVEGTNVRQPVPSMPGVERVSIDLLMGVAEQCVE
LGVPVLSLFPAIEPSLKTPDGREAANPEGLIPRAVRELKRRFPELGVLTDVALDPYTSHG
QDGVLDEAGYVLNDETLEILVEQARAQAEAGVDIVAPSDMMDGRIGAVREMLEREGHIYT
RIMAYSAKYASAFYGPFRDAVGSASNLGKGNKMTYQMDPANSDEALREVRLDIDEGADMV
MVKPGMPYLDIVRRVKDEFRYPTYVYQVSGEYAMLKAAAQNGWLDHDKVVLESLLAFKRA
GADGILTYFALDAARLLRAQK
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcgacgatttctcgcgacgcctgatgcgcgaaaatatcctcaccacgaacgat
ctgatctacccggtgttcgtcgtcgaaggcacgaacgtgcgccagccggtgccgtcgatg
ccgggcgtcgagcgcgtgtcgatcgatctgctgatgggtgtcgccgagcaatgcgtcgag
ctcggcgtgccggtcctgtcgctctttccggccatcgagccgtcgctgaagacgcccgac
ggccgcgaagcggccaatcccgaagggctgatcccgcgtgcggtacgcgagctgaagcgc
cgcttccccgaactcggcgtgctgaccgacgtcgcgctcgatccgtacacgagccacggc
caggacggcgtgctcgacgaggccggctatgtgctcaacgacgaaacgctcgagattctc
gtcgagcaggcgcgcgcgcaggccgaagcgggcgtcgacatcgtcgcgccgtcggacatg
atggacgggcgcatcggcgcggtgcgcgagatgctcgagcgtgaaggccacatctacacg
cggatcatggcctactcggcgaagtacgcgtcggcgttctacggcccgttccgcgacgcg
gtcggctccgcgtcgaatctcggcaagggcaacaagatgacctaccagatggaccccgcg
aacagcgacgaggcgctgcgcgaagtgcgcctcgacatcgacgagggcgcggacatggtc
atggtgaagcccggcatgccgtatctcgacatcgtgcgccgcgtgaaggacgaattccgc
tatccgacctacgtctatcaggtgagcggcgaatacgcgatgctgaaggccgccgcgcag
aacggctggctcgatcacgacaaagtcgtgctcgaatcgctgctcgcgttcaagcgcgcg
ggcgcggacggcattctcacgtacttcgcgctcgacgcggcgcggctgctgcgcgcgcag
aagtaa

DBGET integrated database retrieval system