KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0528Help
Entry
BP1026B_II0528    CDS       T02049                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    BP1026B_II0528 (speB)
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     BP1026B_II0528 (speB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:649421..650383
Genome map
AA seq 320 aa AA seqDB search
MNETLYGDGAIRRPSIYGSSVENTYAGVLSFMRRNYTRDLGGVDVAVCGVPLDLATTFRS
GARLGPAAVRAASVQLAELRPYPWGFDPFDDLAVIDYGDCWFDAHNPLSIKPAIVEHART
ILQSGAAMLTLGGDHYITYPLLIAHAQRHGKPLSLIHFDAHCDTWADDAPDSLNHGTMFY
KAVNEGLIDPKTSVQVGIRTWNDDYLGIHVLDAAWVHEHGPRATAERIASIVGGRPAYLT
FDIDCLDPAFAPGTGTPVAGGLSSAQALAIVRGLGGVNLIGADVVEVAPAYDQSEITAIA
AAHVACDLLCLWRQRKTGAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacgctctatggcgacggcgcgatccgccgcccttccatctacggttcctcg
gtcgaaaacacttacgcgggcgtgctgtcgttcatgcggcgcaactacacgcgcgatctc
ggcggtgtcgacgtcgccgtctgcggcgtgccgctcgatctcgcgacgacgttccgctcc
ggcgcgcgcctgggccctgcggcggtacgcgcggcgagcgtgcagcttgccgaactgcgc
ccgtacccttgggggttcgatccgttcgacgatctcgcggtgatcgactatggcgactgc
tggttcgacgcgcacaatccgctgtcgatcaagcccgcgatcgtcgagcacgcgcgcacg
atcctgcaatcgggcgcggcgatgctgacgttgggcggcgatcactacatcacgtatccg
ctgctgatcgcgcacgcacagcggcacggcaagccgctgtcgctgattcacttcgacgcg
cattgcgacacctgggccgacgacgcgcccgacagcctcaatcacggcacgatgttctac
aaggcggtcaacgaagggctgatcgatccgaagacgtcggtgcaggtcggcatccgtacg
tggaacgacgattacctcggcatccacgtgctcgacgccgcctgggtgcacgagcacggg
ccgcgcgcgacggccgagcgcatcgcgtcgatcgtcggcggccggcccgcgtatctgacg
ttcgacatcgattgcctcgatcccgcgttcgcgccgggcacgggcacgccggtcgcgggc
gggctgtcgtccgcgcaggcgctcgcgatcgtgcgcggtctcggcggcgtgaacctgatc
ggtgcggacgtcgtcgaagtcgcgcccgcgtatgaccagagcgagatcaccgcgatcgcc
gccgcgcacgtcgcgtgcgatctgctgtgcctgtggcggcagcgcaagacgggcgcgcgc
tga

DBGET integrated database retrieval system