KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0674Help
Entry
BP1026B_II0674    CDS       T02049                                 

Definition
Phosphoenolpyruvate phosphomutase
Orthology
K01841  
phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Phosphonate and phosphinate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Metabolism of other amino acids; Phosphonate and phosphinate metabolism [PATH:bpz00440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(838731..839642)
Genome map
AA seq 303 aa AA seqDB search
MPIRELISAPITNEQRRRSFKEKLATGRALRFIESHSPISAMISEKVYVAHGASQSEFDG
FWSSSLTDSTLRGRPDIEILDIASRLANVQHIFDVTTKPLIIDGDTGGKPEHFALNVQSL
ERSGVSAVIIEDKTGLKKNSLLGNDVIQHQESIEDFCEKIRVGKAAQITDDFQIIARVES
LILDKGMPDALARAAAYCEAGADGVMIHSRKKDADEVIEFAQRFRACRRDAYLVCVPTSF
NAISFSELARHFSVVIYANHLLRAAYPAMLAVAEGILAHGRTLEIEERCLPVNEILKLIP
GTA
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtgccaataagagaattaataagcgcgccgattaccaacgaacaaagacgccgatcgttc
aaggaaaagctggcaaccgggcgcgcgctgcgcttcatcgaaagccacagcccgatttcc
gcaatgatcagcgaaaaggtttatgttgcgcacggagcgtctcaatccgagttcgacggc
ttctggtcgagttcactgaccgactcgacgctgcgcggccggccggacatcgaaatcctg
gatatcgcgagcaggctcgccaatgtccagcatattttcgacgtgacgacgaagccgctc
atcatcgacggcgacacgggcggcaagcccgagcatttcgcgctgaacgtgcagtcgctc
gagcgatccggcgtctcggcggtgatcatcgaggacaaaacggggttgaagaaaaattcg
ctgctcggcaacgacgtgattcagcaccaggaatcgatcgaggatttctgcgaaaagatt
cgcgtcggcaaggccgcgcagatcaccgacgattttcagatcatcgcccgcgtcgagagc
ctgattctcgacaagggcatgccggacgcgctcgcgcgcgcggccgcgtattgcgaggcc
ggcgccgacggcgtgatgatccacagccgcaagaaggacgcggacgaagtgatcgaattc
gcgcagcggttccgcgcatgccgccgcgacgcgtatctcgtgtgcgtgccgacgagcttc
aacgcgatttcgttcagcgagctcgcgcgccacttcagcgtcgtgatctacgcgaatcac
ctgctgcgcgccgcgtatccggcgatgctcgcggtcgccgagggcattctcgcgcacggc
cgcacgctcgagatcgaagaacgctgcctgcccgtcaacgagatcctgaagctcattccg
ggaaccgcgtga

DBGET integrated database retrieval system