KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0683Help
Entry
BP1026B_II0683    CDS       T02049                                 

Definition
(GenBank) AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00010  Glycolysis / Gluconeogenesis
bpz00620  Pyruvate metabolism
bpz00640  Propanoate metabolism
bpz00680  Methane metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_II0683
   00620 Pyruvate metabolism
    BP1026B_II0683
   00640 Propanoate metabolism
    BP1026B_II0683
  Energy metabolism
   00680 Methane metabolism
    BP1026B_II0683
Enzymes [BR:bpz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     BP1026B_II0683
Lipid biosynthesis proteins [BR:bpz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   BP1026B_II0683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: AFI68942
UniProt: A0A0H3HST3
Position
2:849395..851098
Genome map
AA seq 567 aa AA seqDB search
MTAQAFLDARDFLLRHRTDYDTAYRDFRWPALDEFNWALDYFDAIARGNDKPALWIVDAA
SGDGARYSFAQMSERSARIANWLREIGVARGERILLMLPNRVELWDTMLAAMKLGAVVLP
ATTQLSADDVRERVQIGGARYAIVDEHEAEKFEQPGLDVTKIVAGAPRAGWLALADGYRA
PAEFAPDARTRASDPMLLYFTSGTTSKPKLVEHTHRTYPVGSLSTMYWVGLQPGDIHWNI
SSPGWAKHAWSCFYAPWNAQACVFAFNYARFEPKVVLDALVKYQVTTMCAPPTVWRMLVQ
QPLSTFAVKLREIVGAGEPLNPEIIERVRKAWGVTIRDGYGQTETTCLIGNSPGQPVVPG
SMGRPLPGYAIALLDPDGAHASEGEIALPVGPDVERPVGLMKGYASNPEATAHAMRDGHY
RTSDIALRRDDGYFVYVGRADDVFKSSDYRLSPFELESVLIEHEAIAEAAVVPSPDPVRL
SVPKTFVMLRAGYEPSETLAREIFRFSREKLAPYKRIRRLQFAELPKTISGKIRRVELRR
RELERGDDASSRMPGEYWEEDFAADGK
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgacggcacaggcgttcctcgacgcacgcgattttctgctgcgccaccgcaccgactac
gacaccgcctatcgcgatttcagatggccggcgctcgacgaattcaactgggcgctcgac
tatttcgacgcgatcgcgcgcggcaacgacaagcccgcactatggatcgtcgacgcggcg
tcgggcgacggcgcgcggtactcgttcgcgcagatgtcggagcgctccgcgcggatcgcg
aactggctgcgcgaaatcggtgtcgcacgcggcgagcggattctgctgatgctgccgaat
cgcgtcgagctgtgggacacgatgctcgcggcgatgaagctgggcgcggtcgtgctgccc
gcgacgacgcaactgtccgccgacgacgtgcgcgagcgcgtgcagatcggcggcgcgcgc
tatgcgatcgtcgacgagcacgaagccgagaagttcgagcagccggggctcgacgtgacg
aagatcgtcgcgggcgcgccgcgcgccggatggctcgcgctcgccgacggctatcgcgcg
ccggccgagttcgcgcccgacgcgcgcacgcgcgcgagcgacccgatgctgctgtacttc
acgtcgggcaccacatcgaagccgaagctcgtcgagcacacgcaccgcacgtacccggtc
ggcagcctgtcgacgatgtactgggtcggcctgcagcccggcgacatccactggaacatc
agctcgcccggctgggcgaagcacgcgtggagctgcttctacgcgccgtggaacgcgcag
gcgtgcgtgttcgcgttcaactacgcccgcttcgagccgaaggtggtgctcgatgcgctc
gtcaagtaccaggtgacgacgatgtgcgcgccgccgaccgtctggcgaatgctcgtgcag
cagccgctttcgacgttcgccgtgaagctgcgcgagatcgtcggcgcgggcgagccgctc
aaccccgagatcatcgagcgcgtgagaaaggcgtggggcgtgacgatccgcgacggctac
gggcagaccgagacgacctgcctgatcggcaattcgccgggccagccggtcgtgccgggc
tcgatgggccggccgctgccgggctatgcgatcgcgctgctcgatcccgacggcgcgcac
gcgagcgaaggcgagatcgcgctgccggtcggcccggatgtcgagcgcccggtcggcctg
atgaagggctacgcgagcaatccggaggcgaccgcgcacgcgatgcgcgacggccattac
cggacgtccgacatcgcgctgcgccgcgacgacggctatttcgtctacgtcggccgcgcg
gacgacgtgttcaagtcgtccgactaccggctgagcccgttcgagctcgagagcgtgctg
atcgagcacgaggcgatcgccgaggcggccgtcgtgccgagcccggacccggtgcggctg
tcggtgccgaagaccttcgtcatgctgcgcgcgggctacgagccgagcgagacgctcgcg
cgcgagatcttccgcttctcgcgcgagaagctcgcgccgtacaagcggattcggcggttg
cagttcgccgagctgccgaagacgatctccggcaagatccgccgcgtcgagctgcgccgc
cgcgagctggagcgcggcgacgacgcgtcgagccggatgcccggcgaatactgggaagag
gatttcgcggccgacggcaagtga

DBGET integrated database retrieval system