KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0750Help
Entry
BP1026B_II0750    CDS       T02049                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:921586..923556
Genome map
AA seq 656 aa AA seqDB search
MCGITGFVGPVACAPQTARATLARMTDSLAHRGPDDTGLWIDHDAGVALGHRRLSIVDLS
EHGHQPMLSACGRYAMTFNGEIYNFRELRSELEREHRAPEWRGHSDSEVLLAAFCAWGVD
RALQKAVGMFALALWNRESRVLTLARDRIGEKPLYYGRIGGSFVFGSELKALRRFPGFDA
HPIDRDALCLYLRHASVPAPYTIYEGIRKLPPGTYAQFEDLAEAPAPRRYWSLERAIAAG
RANPFDGDANAAVAQLDHVLRDAIAEQSVADVPLGAFLSGGVDSSVIVALMQTQTAQPVQ
TFTIGFHEAGYDEAGYAKAVARHLGTSHTELYVKPADVLATVPRMPCVYDEPFADSSQIP
TLLVSELTRRHVKVSLSGDGGDELFGGYTRYFLTPRLWGRLRRVPAAVRMRIAAALHALR
PDHADQIASLVQGAWSASAQRDASPRVGDRLHKLANVMTADSRASLYRLLMSSVHHPERF
TLAGHEPQTLIDTPGAWPPGLSFAEQAMAVDTLTYLPTDILTKVDRAAMAVSLETRMPFL
DHRVVEFAWRLPEALRIPDGQDKWLLRKLLYRYVPRPLIDRPKQGFCAPVGAWLRGELSD
WAAELLRPARLRDEGYLDAARVERLWRQHQSGRMNWQHPLWTVLMFQAWLERQRAE
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatcaccggcttcgtgggccctgtcgcatgcgcgccgcagacggctcgcgcg
accctcgcgcgaatgacggacagtctcgcgcatcgcggcccggacgataccggtttgtgg
atcgatcacgacgcgggcgtcgcgctcggccatcggcgcctgtcgatcgtcgacttgtcc
gagcacgggcatcagccgatgctgtccgcgtgcggccgttatgcgatgacgttcaacggc
gagatctacaactttcgcgagttgcgcagcgagctcgagcgcgagcatcgcgcgcccgaa
tggcgcggtcattcggatagcgaagtgttgctcgcggcgttctgcgcgtggggcgtcgat
cgcgcgttgcaaaaggcggtcggcatgttcgcgctcgcgctgtggaaccgcgaatcgcgc
gtgctcacgctcgcgcgcgatcgcatcggcgagaagccgctctattacggccgcatcggc
ggctcgttcgtgttcggctccgagctgaaggcgctgcggcgttttcccggcttcgacgcg
catccgatcgaccgcgacgcgctgtgcctgtatctgcgccacgcgagcgtgcccgcgccg
tacacgatctacgaaggcatccgcaagctgccgcccggcacgtacgcgcagttcgaggac
ctcgccgaagcgcccgcgccgcgccgctactggtcgctcgagcgcgcgatcgccgcaggc
cgcgcgaatccgttcgacggcgacgcgaacgccgccgtcgcgcagctcgatcacgtgttg
cgcgacgcgatcgccgagcagtcggtcgccgacgtgccgctcggcgcgttcctgtcgggc
ggcgtcgattcgtcggtgatcgtcgcgctgatgcagacgcagaccgcgcagccggtgcag
accttcacgatcggctttcacgaggcgggctacgacgaggccggctatgcgaaggcggtt
gcgcggcatctgggcacgtcgcacaccgagctctacgtgaagccggccgacgtgctcgcg
accgtcccgcgcatgccgtgcgtctacgacgagccgttcgccgattcgtcgcagattccg
acgctgctcgtctccgagctcacccgccggcacgtgaaggtgagcctgtccggcgacggc
ggtgacgagctgttcggcggctacacgcgctatttcctgacgccgcgcctatgggggcgg
ctgcgccgcgtgccggccgcggtgcggatgcggatcgcggccgcgctgcacgcgctgcgg
cccgaccatgcggatcagatcgcctcgctcgtgcagggcgcgtggagcgcgtccgcgcag
cgcgacgcgtcgccgcgcgtcggggaccgcctgcacaagctcgcgaacgtgatgacggcg
gacagccgcgcgtcgctgtaccggttgctgatgtcgtcggtccatcatccggagcgcttc
acgctcgcggggcacgagccgcagacgctgatcgacacgccgggcgcgtggccccccggg
ctgtcgttcgccgagcaggccatggccgtcgatacgctcacgtatctgccgaccgacatc
ctgacgaaagtcgaccgcgcggcgatggcggtgagcctcgagacgcggatgccgtttctc
gatcaccgcgtcgtcgagttcgcgtggcggctgccggaggcgctgcgcatcccggatggg
caggacaagtggttgctgcgcaagctgctgtatcgctacgtgccgcgcccgctgatcgac
cggccgaaacagggcttctgcgcgcccgtcggcgcgtggctgcgcggcgaattgagcgac
tgggcggcggagttgctgcgccccgcgcgcctgcgcgacgaaggctacctcgacgcggcg
cgcgtcgagcgcctgtggcggcagcaccagtcgggccggatgaactggcagcacccgctc
tggacggtgctgatgttccaggcatggctcgagcggcagcgcgccgagtag

DBGET integrated database retrieval system