KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0790Help
Entry
BP1026B_II0790    CDS       T02049                                 

Definition
hydrolase alpha/beta fold domain-containing protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Brite
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     BP1026B_II0790
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(968252..969073)
Genome map
AA seq 273 aa AA seqDB search
MTGRTGILLIHGLGGTQYDLGSLHKAMRRAGGDTHMITLPGHGTRPEDLVDVRAEAWLDA
VTAQYRALEREYDTVHVAGMCMGALVARLLCRRVRHARGRLALLAAPMFIDGWSTPWYRS
LRHLLYRVPGVPARLRVDEDEPFGIKNPTIRAIVKKKFERQDNFHYPWVPLACIRQVDRL
RSWARAAAADTHCPTLVLHAREDELTSLRSADFLLKHLPDARGIVLENSYHMICADNDRD
EVARQVLTFFGFDPSHAMSPAMARRMGRADPRA
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgaccggccgaacgggcattctgctgatccacgggctcggcgggacgcagtacgatctc
ggctcgctgcacaaggcgatgcgccgggcgggcggcgacacgcacatgatcacgctgccg
gggcacggcacgcgccccgaggatctcgtcgacgtgcgcgcggaagcgtggctcgacgcg
gtcaccgcgcagtatcgcgcgctcgagcgcgagtacgacaccgtgcatgtcgcgggcatg
tgcatgggcgcgctcgtcgcgcggctgctgtgccggcgcgtgcggcacgcgcgcgggcgg
ctcgcgctgttggccgcgccgatgttcatcgacggctggtcgacgccctggtaccgatcg
ctgcgacatctgctgtaccgcgtgcccggcgtgccggcgcggctgcgcgtcgacgaggac
gagccgttcggcatcaagaacccgacgattcgcgcgatcgtgaagaagaagttcgagcgt
caggacaacttccactatccgtgggtgccgcttgcatgcatccgccaggtcgatcgcctg
cgaagctgggcgcgcgcggcggcggccgacacgcactgcccgacgctcgtgctgcatgcg
cgggaggacgagctcacgagcctgcgctcggcggacttcctgctgaagcacctgcccgac
gcgcgcgggatcgtgctggagaacagctaccacatgatctgcgcggacaacgatcgcgac
gaagtcgcccggcaggtgctgacgtttttcggcttcgatccgtcacatgcgatgagcccg
gcgatggcgcgccggatggggcgcgccgatccgcgagcgtga

DBGET integrated database retrieval system