KEGG   Burkholderia pseudomallei 1026b: BP1026B_II0842Help
Entry
BP1026B_II0842    CDS       T02049                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bpz  Burkholderia pseudomallei 1026b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1033809..1035419)
Genome map
AA seq 536 aa AA seqDB search
MRRARSARRRPHATRARYITDARPAGARNAGRHSGATHAGFFFCMITTERSSMAEPLCAQ
PAPSTRSDACAPAALATVSRRRGRRNARAMRHAPAAAAFGVLGFAAFALAFPEHVPNAVG
AIVENLTGANPQPVALRRPGAEPLSAVAQLGRALFFDPALSASGRQSCASCHSPDHAYGP
PNDLDVQLGGAALTQPGYRPPPSLMYLYRQPNFSIGPDSSENDDTASVAQQAASAAGAVR
ARKSAGAAAAPQLVPQGGMFWDGRADTLQQQAFGPLMNPVEMANASTGDVARKLAHARYA
PQFRQLFGPHIFDDARLAVSEAMFAIARYQVEDPSFHPYSSKYDRWLEGDARLTQAELRG
MRRFNDPNKANCAGCHLSKPSADGLPPMFTDFQYEALGVPRNRALAQNRNPAFHDLGICG
PFRDNLKTQTQYCAMFATPSLRNVATRRVFFHNGVYHSLDRVLAFYNLRSVDPGKIYPRD
ASGRVLQYDDIPSAYRANVDVADAPFDRKPGDAPAMTEQDMRDIVAFLNTLTDEKR
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgcgccgcgcacgctcggcgcggcgccgcccgcacgcgacgcgcgcccgatacatcacc
gatgcacggccggccggcgcacgcaacgccggccgtcattccggcgcgacgcacgccgga
tttttcttttgcatgatcacgaccgaacgctccagcatggccgaaccgctttgcgcgcaa
cccgctccgtccacccgatccgacgcatgcgcgccggccgcgcttgccaccgtctcgcgc
cgccgcggccgccgcaacgcgcgcgcgatgcgccacgcgccggcggccgccgcgttcggc
gtgctcggcttcgccgcgttcgcgctggcgtttcccgagcatgtgccgaacgcggtcggc
gcgatcgtcgaaaacctcacgggcgcgaatccgcagccggtcgcgctgcgccgcccgggc
gccgagccgctgagcgcggtcgcgcagctcggccgcgcgctgttcttcgatcccgcgctg
tccgcgtcgggccggcaatcgtgtgcgtcgtgccacagccccgatcatgcgtacggcccg
ccgaacgatctggacgtgcaactgggcggcgccgcgttgacgcagcccggctatcggccg
ccgccgtcgctgatgtatctgtaccggcagccgaacttcagcatcggcccggactcgtcc
gagaacgacgacacggcgagcgtcgcgcaacaggccgcatccgcggcgggcgccgtgcgc
gcgcggaagagcgccggcgcggcggccgcgccgcagctcgtgccgcagggcgggatgttc
tgggacggccgcgcggatacgctgcagcagcaggcgttcggcccgttgatgaatccggtc
gagatggcgaacgcgagcaccggcgacgtcgcgcgcaagctcgcgcacgcgcgctacgcg
ccgcagttccggcagttgttcggcccgcacatcttcgacgacgcacgtcttgcggtgtcc
gaagcgatgttcgcgatcgcgcgctaccaggtggaggacccgtcgttccatccgtattcg
agcaagtacgaccgctggctcgaaggcgacgcgcggctcacgcaggcggagctgcgcggc
atgcggcgcttcaacgatccgaacaaggcgaattgcgcgggctgccacctgtcgaagccg
agcgcggacggtctgccgccgatgttcaccgatttccagtacgaggcgctcggcgtgccg
cgcaaccgcgcgctcgcgcagaaccgcaatccggcgttccacgatctcggcatctgcggg
ccgtttcgcgacaacttgaagacgcagacgcaatactgcgcgatgttcgcgacgccttcg
ctgcgcaacgtcgcgacgcgccgcgtgttcttccacaacggcgtctatcattcgctcgac
cgggtgctcgcgttctacaacctgcgcagcgtcgatccgggcaagatctatccgcgcgac
gcaagcggccgggtgctgcaatacgacgacatcccgagcgcgtatcgcgcgaacgtcgac
gtcgccgatgcgccgttcgaccgcaagccgggcgacgcgcccgcgatgaccgagcaggac
atgcgcgacatcgttgcgtttctgaacacgctgaccgacgagaagcgctga

DBGET integrated database retrieval system