KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1260Help
Entry
BP1026B_II1260    CDS       T02049                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Organism
bpz  Burkholderia pseudomallei 1026b
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1569419..1570483)
Genome map
AA seq 354 aa AA seqDB search
MSRTRLLSELVPGLDTLVRPLDLLARPTPVTEEPELARRWGQAGLWIKRDDLANPLYGGS
KVRTLEFFLGRARAQRADGIVTMGPYGSHQLLATAVFGRRTGFLTRGVATPQPDVPEIAL
NRRLLPAYGMEVMRCASFAAVPAALLRARLKPLGAGRPFWIPPGANHPLGVMGVVEGALE
VAQAIRAGSLPVPDDVVVPTGTCATAAGVYLGFALAGLDVRVVAVRMVPMIVTGPAKLLR
MARQTERLLRRYGLTAPARWGELLWTNDHAGPSYGRAGLVAERARADVAQFGAFRTETTY
TAKTLALLAGGGLQRRRVLFWNTYSAIDPDPSRDAGGACAWPDGEPSAHSATAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacacgcctgctttccgaactggttcccgggctcgacacgctcgtcaggccg
ctcgatctgctcgcgcggcccacgccggtgaccgaggagccggagctcgcgcgtcgctgg
gggcaggccggcctgtggatcaagcgcgacgatctcgcgaatccgctctacggcggcagc
aaggtccgcacgctcgagttcttcctcggccgcgcgcgcgcgcaacgcgcggacggcatc
gtcacgatggggccctatggcagtcatcagttgctcgcgaccgcggtgttcggccggcgg
accggttttctcacgcgcggcgtcgcgacgccgcagcccgacgtgccggagatcgcgctg
aaccgccggctgctgcccgcgtacggaatggaggtgatgcgctgcgcgagcttcgccgcg
gtgcccgccgcgctgctgcgcgcgcggctcaagccgctcggcgccgggcggccgttctgg
attccgcccggcgcgaatcacccgctcggcgtgatgggcgtcgtcgagggcgcgctcgaa
gtcgcgcaggcgatccgcgcgggcagcctgccggttccggacgacgtcgtcgtgcccacc
ggcacctgcgcgacggcggcgggcgtctacctgggcttcgcgctcgccgggctcgacgtg
cgggtcgtcgcggtgcggatggtgccgatgatcgtcaccgggccggcgaagctgctgcgc
atggcccggcagaccgagcggctgctgcgccgctacggcctgacggcgcccgcgcgctgg
ggcgagctgctgtggaccaacgatcatgcggggccgagctatgggcgcgccggcctcgtc
gccgagcgcgcacgcgccgacgtcgcgcaattcggcgcgttccgcaccgagaccacctac
accgcgaagacgctcgcgctgctcgcgggcggcggcctgcagcggcggcgggtgctgttc
tggaacacctacagcgcgatcgaccccgacccgtcgcgcgatgccggcggcgcatgcgcg
tggcccgacggcgagccctctgcccattccgcaaccgcaccgtag

DBGET integrated database retrieval system