KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1260Help
Entry
BP1026B_II1260    CDS       T02049                                 

Definition
1-aminocyclopropane-1-carboxylate deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    BP1026B_II1260
Enzymes [BR:bpz01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     BP1026B_II1260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(1569419..1570483)
Genome map
AA seq 354 aa AA seqDB search
MSRTRLLSELVPGLDTLVRPLDLLARPTPVTEEPELARRWGQAGLWIKRDDLANPLYGGS
KVRTLEFFLGRARAQRADGIVTMGPYGSHQLLATAVFGRRTGFLTRGVATPQPDVPEIAL
NRRLLPAYGMEVMRCASFAAVPAALLRARLKPLGAGRPFWIPPGANHPLGVMGVVEGALE
VAQAIRAGSLPVPDDVVVPTGTCATAAGVYLGFALAGLDVRVVAVRMVPMIVTGPAKLLR
MARQTERLLRRYGLTAPARWGELLWTNDHAGPSYGRAGLVAERARADVAQFGAFRTETTY
TAKTLALLAGGGLQRRRVLFWNTYSAIDPDPSRDAGGACAWPDGEPSAHSATAP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgagccgcacacgcctgctttccgaactggttcccgggctcgacacgctcgtcaggccg
ctcgatctgctcgcgcggcccacgccggtgaccgaggagccggagctcgcgcgtcgctgg
gggcaggccggcctgtggatcaagcgcgacgatctcgcgaatccgctctacggcggcagc
aaggtccgcacgctcgagttcttcctcggccgcgcgcgcgcgcaacgcgcggacggcatc
gtcacgatggggccctatggcagtcatcagttgctcgcgaccgcggtgttcggccggcgg
accggttttctcacgcgcggcgtcgcgacgccgcagcccgacgtgccggagatcgcgctg
aaccgccggctgctgcccgcgtacggaatggaggtgatgcgctgcgcgagcttcgccgcg
gtgcccgccgcgctgctgcgcgcgcggctcaagccgctcggcgccgggcggccgttctgg
attccgcccggcgcgaatcacccgctcggcgtgatgggcgtcgtcgagggcgcgctcgaa
gtcgcgcaggcgatccgcgcgggcagcctgccggttccggacgacgtcgtcgtgcccacc
ggcacctgcgcgacggcggcgggcgtctacctgggcttcgcgctcgccgggctcgacgtg
cgggtcgtcgcggtgcggatggtgccgatgatcgtcaccgggccggcgaagctgctgcgc
atggcccggcagaccgagcggctgctgcgccgctacggcctgacggcgcccgcgcgctgg
ggcgagctgctgtggaccaacgatcatgcggggccgagctatgggcgcgccggcctcgtc
gccgagcgcgcacgcgccgacgtcgcgcaattcggcgcgttccgcaccgagaccacctac
accgcgaagacgctcgcgctgctcgcgggcggcggcctgcagcggcggcgggtgctgttc
tggaacacctacagcgcgatcgaccccgacccgtcgcgcgatgccggcggcgcatgcgcg
tggcccgacggcgagccctctgcccattccgcaaccgcaccgtag

DBGET integrated database retrieval system