KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1274Help
Entry
BP1026B_II1274    CDS       T02049                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bpz00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bpz00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:1595934..1597229
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERAPAADGYAQSVDSRQPLAQQFLFEGRPQLLSVDQFSRDSVEALFRVADVMQPIARRR
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEQGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGACIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIVDQISKNGHVVEE
THDLAAGLKGADVVYATRIQKERFTDESFEGYTPDFQINQARVDAACGPDTLIMHPLPRD
SRPGANDLSTDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVEHLVQHSMRDATWRPPTYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttcctcagcaagcgttcctgcgcgacgcgatgcgccgcctgaacatgacccgc
gaagcgttcgcgaaccgcatcggcgtgagccggcgcgccctcgacacatggctgttgccg
gacgattcgcaggaatcgcgcggcatgcccgagatcgtcgagcgtttcgtctccgaaatc
gtcgagcgcgcgccggccgccgacggatatgcgcaaagcgtagattctcgacagccgctt
gcgcagcagttcctgttcgaaggccggccgcagttgctgtcggtcgaccagttctcgcgc
gattccgtcgaagcgctgttccgggtcgccgacgtgatgcagccgatcgcgcgccgccgc
aagatctcgcgcgtgctcgagggcgcggtgctcggcaacctgttcttcgaggcgagcacg
cgcacgcgcgtgtcattcggcgccgcgttctgcaggctcggcggctcggtgtgcgacacg
acgggcttcaccttctcgtcgatggccaagggtgaatcgatctacgatacgagccgcgtg
atggccggctacgtcgacgcgctcgtgatccgccatccggaacaaggctcggtcgccgaa
ttcgcgcgcgcgaccaacctgcccgtgatcaacggcggcgacggccccggcgagcatccg
agccaggcactcctcgatctgtatacgatccagcgcgaattctcgcgcctgggcaagatc
gtcgacggcgcgtgcatcgcgctcgtcggcgacctgaagtacggccgcacggtccactcg
ctcgtcaagctgctcgcgctgtatcgcgggctcaagttcacgctcgtctcgccgccgacg
ctcgagatgccggcctacatcgtcgatcagatctcgaagaacggtcacgtcgtcgaggaa
acgcacgacctcgcggcgggcctgaagggcgcggacgtcgtctacgcgacgcggatccag
aaggagcgcttcaccgacgaatcgttcgaaggctatacgcccgacttccagatcaatcag
gcacgggtcgacgcggcctgcggccccgacacgctgatcatgcacccgctgccgcgcgac
agccggcccggtgcgaacgatctgtcgaccgatctgaaccgcgacccgcgcctcgcgatc
ttccgccagaccgacaacgggattccggtgcgcatggcgatcttcgcggtgctgctcggc
gtcgagcatctcgtccaacactcgatgcgcgacgcgacgtggcgtccgcccacgtacctc
gggccggaggacgcggtgttccacgggatcgactaa

DBGET integrated database retrieval system