KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1688Help
Entry
BP1026B_II1688    CDS       T02049                                 

Gene name
bcsZ
Definition
endo-1,4-D-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BP1026B_II1688 (bcsZ)
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     BP1026B_II1688 (bcsZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2120247..2121569)
Genome map
AA seq 440 aa AA seqDB search
MRAVVASVVASFSVMAFAAATLPVSWRVAAAAERTRSGGERAGGLRDTAGLIEISAAAPR
RFAQPFAQTFAQPARAFAAASACAPSWPRWDRFKRDFVSADGRVIDVGSADERTVSEGQA
YGLFFALVANDRAAFDALLRWTEDNLAQGDLSARLPAWLWGRAADGAWRVLDANAASDAD
LWLAYALLEAGRLWRERSYTARGALLAKRVLDEETATLPGLGLVLLPGPTGFRPARDAWR
LNPSYSPPQAIRGIGAHVPDDARWARLAAGVGRVLTDSAPRGFAPDWALYRAGRGFEPDA
ETHAASAYNAIRVYLWAGMLDAGDPLARPLVAHFAPFAEHVAAHGAPPEAVDATTGAAAP
RDGNAGFSAAAVPFLEARGERASADAQLARVARLERETASGYYANVLTLFGLGWRDGRYR
FAADGTLRVRWSEPCSTPAR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcgccgtcgtggcgagcgtcgtggcgagcttctcggtgatggcgttcgcggcggcg
acgttgccggtgtcgtggcgcgtcgccgcggcggcggagcgtacgcgaagcggcggcgaa
cgcgcgggcgggctgcgcgacacggcgggcttgatcgagatctcggcggcggcgccgcgg
cggttcgcgcagccgttcgcgcagacgttcgcgcagccggctcgcgcgttcgccgccgcg
agcgcctgcgcgccgtcctggccgcgctgggaccgtttcaagcgtgacttcgtatcggcc
gacggccgcgtgatcgacgtcggctcggccgacgagcggaccgtatccgaggggcaggcg
tacggccttttcttcgcgctcgtcgcgaacgaccgcgcggcgttcgacgcgctgctgcgc
tggaccgaggacaatctcgcgcagggcgatctgagcgcgcgtctgcccgcgtggctgtgg
ggccgcgcggccgacggcgcgtggcgcgtgctcgatgcgaacgccgcgtccgacgccgat
ctgtggcttgcgtacgcgctgctcgaagcggggcgcttgtggcgcgagcgcagctacacg
gcgcgcggcgcgttgctcgcgaagcgcgtgctcgacgaggagaccgcgacgctgccgggg
ctcggtctcgtgctgctgccgggcccgacgggttttcggccggcgcgcgacgcgtggcgg
ctgaatccgagctattcgccgccgcaggcgattcgcggaatcggcgcgcatgtgcccgac
gacgcgcgctgggcgcggctcgcggcgggcgtcggccgcgtgctgaccgacagcgcgccg
cgcggcttcgcgccggactgggcgctgtatcgcgcgggccgcggcttcgagccggacgcc
gaaacgcatgcggcgagcgcgtacaacgcgattcgcgtctatctgtgggcgggcatgctc
gatgcgggcgatccgctggcgcggccgctcgtcgcgcatttcgcgccgttcgccgagcat
gtcgccgcgcatggcgcgccgccggaggcggtcgatgcgacgacgggcgcggccgccccg
cgcgacggcaatgccgggttttccgcggcggccgtgccgtttctcgaggcgcgcggcgag
cgggcgagcgccgacgcgcagctcgcgcgcgtcgcgcggctcgagcgcgagacggcgagc
ggctattacgcgaacgtgctgacgctgttcgggctcggctggcgcgacgggcgctaccgg
ttcgcggccgacggcacgctgcgggtgcgatggagcgagccgtgctcgacgcccgcgcgt
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system