KEGG   Burkholderia pseudomallei 1026b: BP1026B_II1799Help
Entry
BP1026B_II1799    CDS       T02049                                 

Gene name
gtaB
Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00040  Pentose and glucuronate interconversions
bpz00052  Galactose metabolism
bpz00500  Starch and sucrose metabolism
bpz00520  Amino sugar and nucleotide sugar metabolism
bpz01100  Metabolic pathways
bpz01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    BP1026B_II1799 (gtaB)
   00052 Galactose metabolism
    BP1026B_II1799 (gtaB)
   00500 Starch and sucrose metabolism
    BP1026B_II1799 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    BP1026B_II1799 (gtaB)
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     BP1026B_II1799 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2
Motif
Other DBs
NCBI-ProteinID: AFI70032
UniProt: A0A0H3HUH1
Position
2:complement(2281567..2282454)
Genome map
AA seq 295 aa AA seqDB search
MLKVTKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSFEIESELEARGKEKLLELVRGIKPSHVDCFYVRQPAALGLGHAVLCAEK
LVHGEPFAVILADDLLHGDQPVLKQLVDVFNHYHSSVIGVETIEREDSRSYGIVEGREWE
EDIIKLSGIIEKPAPEHAPSNLGVVGRYVLMPSIFEHLRKIKPGAGGELQLTDAVQSLLT
EEQVLAYRYYGTRFDCGSKLGYLKATVELALRHPEVGREFEAYLRNCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccaaagccgtgttccccgttgccggtctcggcacacggtttttgccc
gccacgaaggcgagtccgaaggaaatgctgcccgtggtcgacaagccgctgatccagtac
gcggtcgaagaggcgatcaatgcgggcatcaccgagatgatcttcgtgacgggccgcagc
aagcgcgcgatcgaagatcacttcgacaaatcgttcgagatcgaatccgagctcgaggcg
cgcggcaaggaaaagctgctcgaactcgtgcgcggcatcaagccgagccatgtcgactgc
ttctacgtgcgccagccggccgcgctcggcctcggccacgcggtgctctgcgcggagaag
ctcgtgcacggcgagccgttcgcggtgatcctcgccgacgacctgctgcacggcgaccag
ccggtgctcaagcagctcgtcgacgtcttcaaccactatcacagctcggtgatcggcgtc
gagacgatcgagcgcgaggacagccgctcgtacggcatcgtcgaaggccgcgagtgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgcccgagcatgcgccgtcg
aacctcggcgtcgtcggccgctacgtgctgatgccgagcatcttcgagcatctgcgcaag
atcaagccgggcgcgggcggcgaactgcaactgacggacgcggtgcagtcgctgctgacc
gaggagcaggtgctcgcgtaccgctactacggcacccgtttcgactgcggcagcaagctc
ggctatctgaaggcgacggtcgagctcgcgctgcggcatccggaagtgggccgcgaattc
gaggcgtacctgcgcaactgcctgccggcgctcgccgcggttgcttag

DBGET integrated database retrieval system