KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2099Help
Entry
BP1026B_II2099    CDS       T02049                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz00010  Glycolysis / Gluconeogenesis
bpz00030  Pentose phosphate pathway
bpz00051  Fructose and mannose metabolism
bpz00052  Galactose metabolism
bpz00680  Methane metabolism
bpz01100  Metabolic pathways
bpz01110  Biosynthesis of secondary metabolites
bpz01120  Microbial metabolism in diverse environments
bpz01130  Biosynthesis of antibiotics
bpz01200  Carbon metabolism
bpz01230  Biosynthesis of amino acids
Module
bpz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_II2099
   00030 Pentose phosphate pathway
    BP1026B_II2099
   00051 Fructose and mannose metabolism
    BP1026B_II2099
   00052 Galactose metabolism
    BP1026B_II2099
  Energy metabolism
   00680 Methane metabolism
    BP1026B_II2099
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BP1026B_II2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB Phos_pyr_kin
Motif
Other DBs
NCBI-ProteinID: AFI70325
UniProt: A0A0H3HWP7
Position
2:complement(2614001..2614942)
Genome map
AA seq 313 aa AA seqDB search
MSEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYL
AGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPR
CVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAG
VYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVR
LPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGTALGTKEDI
ARIYRELPGMIDA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaatcgtcaccctcacgccgaatcccgccatcgacgtcgcgacctgcgtcgag
cgagtcaccgacacccgcaagctgcgctgcggccccgcacgacgcgatccgggcggcggc
ggaatcaatgtcgcccgcgtgctgacgcgcctcggcgccgattgttcggccgtctacctg
gcgggcggcggcaccggcctcgcgctgcgcggcctgctcgccgacgaaggcgtgcgggcg
catggcatcgacatcgccggcgagacgcgcgaaaacttttcggtgctcgaaacgtcgacg
ggccgcgaattccgcttcgtgttgcccgggccggcgctcgcggcgcacgaatggccgcgc
tgcgtcgaagcgctcgggcggctcgccgacgcgtcgcgctatctggtgatgagcggcagc
ctgccgcccggcatgccggacgattgctacgcccggctcgcgcggcgcgcgagcgcgcgc
ggcgtgcgcacggtcgtcgatacgtcgggaccggcgctcgccgccgcgctcgatgcgggc
gtctatctggtgaagccgagcctcggcgagttgcgcgcgctgaccggcctgccgctcgaa
gacgacggcgcgcgccttgccgccgcgcgcgcgatcgtcgccggcgggcgcgcgcagatc
gtcgcgctgacgctcggcgacgcgggcgcgctcgtcgtgtcgcgcgacgatgcggtgcgt
ctgccgggcgtgaaggtggcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcg
gggctcgtcgccgcgctcaatcgcggcgcgaacgtcgccgacgcggcgcgccatgcgctc
gccgccgcgtcggcgtcgctgctgagcacgggcaccgcgctgggcacgaaggaagacatc
gcgcggatctatcgcgaactgccgggaatgatcgacgcgtga

DBGET integrated database retrieval system