KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2099Help
Entry
BP1026B_II2099    CDS       T02049                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BP1026B_II2099
   01230 Biosynthesis of amino acids
    BP1026B_II2099
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BP1026B_II2099
   00030 Pentose phosphate pathway
    BP1026B_II2099
   00051 Fructose and mannose metabolism
    BP1026B_II2099
   00052 Galactose metabolism
    BP1026B_II2099
  Energy metabolism
   00680 Methane metabolism
    BP1026B_II2099
Enzymes [BR:bpz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     BP1026B_II2099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2614001..2614942)
Genome map
AA seq 313 aa AA seqDB search
MSEIVTLTPNPAIDVATCVERVTDTRKLRCGPARRDPGGGGINVARVLTRLGADCSAVYL
AGGGTGLALRGLLADEGVRAHGIDIAGETRENFSVLETSTGREFRFVLPGPALAAHEWPR
CVEALGRLADASRYLVMSGSLPPGMPDDCYARLARRASARGVRTVVDTSGPALAAALDAG
VYLVKPSLGELRALTGLPLEDDGARLAAARAIVAGGRAQIVALTLGDAGALVVSRDDAVR
LPGVKVAVRSAIGAGDSFVAGLVAALNRGANVADAARHALAAASASLLSTGTALGTKEDI
ARIYRELPGMIDA
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaaatcgtcaccctcacgccgaatcccgccatcgacgtcgcgacctgcgtcgag
cgagtcaccgacacccgcaagctgcgctgcggccccgcacgacgcgatccgggcggcggc
ggaatcaatgtcgcccgcgtgctgacgcgcctcggcgccgattgttcggccgtctacctg
gcgggcggcggcaccggcctcgcgctgcgcggcctgctcgccgacgaaggcgtgcgggcg
catggcatcgacatcgccggcgagacgcgcgaaaacttttcggtgctcgaaacgtcgacg
ggccgcgaattccgcttcgtgttgcccgggccggcgctcgcggcgcacgaatggccgcgc
tgcgtcgaagcgctcgggcggctcgccgacgcgtcgcgctatctggtgatgagcggcagc
ctgccgcccggcatgccggacgattgctacgcccggctcgcgcggcgcgcgagcgcgcgc
ggcgtgcgcacggtcgtcgatacgtcgggaccggcgctcgccgccgcgctcgatgcgggc
gtctatctggtgaagccgagcctcggcgagttgcgcgcgctgaccggcctgccgctcgaa
gacgacggcgcgcgccttgccgccgcgcgcgcgatcgtcgccggcgggcgcgcgcagatc
gtcgcgctgacgctcggcgacgcgggcgcgctcgtcgtgtcgcgcgacgatgcggtgcgt
ctgccgggcgtgaaggtggcggtgcgcagcgcgatcggcgcgggcgacagcttcgtcgcg
gggctcgtcgccgcgctcaatcgcggcgcgaacgtcgccgacgcggcgcgccatgcgctc
gccgccgcgtcggcgtcgctgctgagcacgggcaccgcgctgggcacgaaggaagacatc
gcgcggatctatcgcgaactgccgggaatgatcgacgcgtga

DBGET integrated database retrieval system