KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2195Help
Entry
BP1026B_II2195    CDS       T02049                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bpz01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bpz01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:2724460..2725500
Genome map
AA seq 346 aa AA seqDB search
MKHASAESPDSAGCAETPARAPAGSAADTAAPPAPDERASGHLSRASSARHLGVAALPAA
GTAAAIALWAGFGLAPRVQDIAMLAVFYVLNILGMELALHRYFAHRTFKAKPAVKIALAI
LGSLAYMGPLMWWVAIHRLHHANADRPGDPHTPQLGGRGFAGRAKGILHGHVGWLFDPSS
ARPKGWNQYANDMYRDPTLLRIHLAYDYWLLLGLLLPGALGWLLDPSWRGALLGLLWGGT
VRIFLATNAIWAVNSIGHALGGRRPFPGRDQSRNAAWLALVTLGAGWHNNHHAFPQYAST
RLTRWQIDVTGMLIALLERLGLVWDVQHPDRDAVRERLANARRDDV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcgagcgccgagagccccgatagcgccggctgcgccgagacgccggcgcgc
gcgccggccggctcggcggcggatacggccgccccgcccgcgcccgacgagcgcgcctcc
ggccatctgtcgcgcgcgtcgtccgcgcgccatctgggcgtcgcggcgctgcccgccgcc
ggcacggccgccgcgatcgcgctctgggccgggttcggcctcgcgccgcgcgtgcaggac
atcgccatgctcgcggtcttctacgtgctcaacattctcggcatggagctcgcgctgcac
cgctatttcgcgcatcgcacgttcaaggcgaagccggccgtgaagatcgcgctcgcgatc
ctcggctcgctcgcgtacatggggccgctgatgtggtgggtggcgatccaccggctgcat
cacgcgaacgccgaccggccgggcgacccgcacacgccgcaactcggcgggcgcggcttc
gccggccgcgcgaagggcatcctgcacgggcacgtcggctggctgttcgatccgtcgtcc
gcgcgcccgaagggctggaaccaatatgcgaacgacatgtaccgcgacccgacgctgctg
cgcatccatctcgcgtacgactactggctgctgctcggcctgctgctgccgggcgcgctc
ggctggctgctcgatccttcgtggcggggcgcgctgctcggcctgctgtggggcggcacc
gtgcggatctttctcgcgacgaacgcgatctgggcggtcaattcgatcggccacgcgctc
ggcggccggcggccgtttcccggccgcgaccagagccgcaacgcggcgtggctcgcgctc
gtcacgctcggcgcgggctggcacaacaaccatcacgcgtttccgcagtatgcgagcacg
cgcctgacccgctggcagatcgacgtgaccggcatgctgatcgcgctgcttgaacggctg
gggctcgtatgggacgttcagcacccggaccgggacgcggtgcgcgagcggctcgcgaac
gcacggcgcgacgacgtgtag

DBGET integrated database retrieval system