KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2195Help
Entry
BP1026B_II2195    CDS       T02049                                 

Definition
(GenBank) hypothetical protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
bpz01040  Biosynthesis of unsaturated fatty acids
bpz01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    BP1026B_II2195
Enzymes [BR:bpz01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     BP1026B_II2195
Lipid biosynthesis proteins [BR:bpz01004]
 Desaturase
  First
   BP1026B_II2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DUF3302
Motif
Other DBs
NCBI-ProteinID: AFI70417
UniProt: A0A0H3HVM7
Position
2:2724460..2725500
Genome map
AA seq 346 aa AA seqDB search
MKHASAESPDSAGCAETPARAPAGSAADTAAPPAPDERASGHLSRASSARHLGVAALPAA
GTAAAIALWAGFGLAPRVQDIAMLAVFYVLNILGMELALHRYFAHRTFKAKPAVKIALAI
LGSLAYMGPLMWWVAIHRLHHANADRPGDPHTPQLGGRGFAGRAKGILHGHVGWLFDPSS
ARPKGWNQYANDMYRDPTLLRIHLAYDYWLLLGLLLPGALGWLLDPSWRGALLGLLWGGT
VRIFLATNAIWAVNSIGHALGGRRPFPGRDQSRNAAWLALVTLGAGWHNNHHAFPQYAST
RLTRWQIDVTGMLIALLERLGLVWDVQHPDRDAVRERLANARRDDV
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaagcacgcgagcgccgagagccccgatagcgccggctgcgccgagacgccggcgcgc
gcgccggccggctcggcggcggatacggccgccccgcccgcgcccgacgagcgcgcctcc
ggccatctgtcgcgcgcgtcgtccgcgcgccatctgggcgtcgcggcgctgcccgccgcc
ggcacggccgccgcgatcgcgctctgggccgggttcggcctcgcgccgcgcgtgcaggac
atcgccatgctcgcggtcttctacgtgctcaacattctcggcatggagctcgcgctgcac
cgctatttcgcgcatcgcacgttcaaggcgaagccggccgtgaagatcgcgctcgcgatc
ctcggctcgctcgcgtacatggggccgctgatgtggtgggtggcgatccaccggctgcat
cacgcgaacgccgaccggccgggcgacccgcacacgccgcaactcggcgggcgcggcttc
gccggccgcgcgaagggcatcctgcacgggcacgtcggctggctgttcgatccgtcgtcc
gcgcgcccgaagggctggaaccaatatgcgaacgacatgtaccgcgacccgacgctgctg
cgcatccatctcgcgtacgactactggctgctgctcggcctgctgctgccgggcgcgctc
ggctggctgctcgatccttcgtggcggggcgcgctgctcggcctgctgtggggcggcacc
gtgcggatctttctcgcgacgaacgcgatctgggcggtcaattcgatcggccacgcgctc
ggcggccggcggccgtttcccggccgcgaccagagccgcaacgcggcgtggctcgcgctc
gtcacgctcggcgcgggctggcacaacaaccatcacgcgtttccgcagtatgcgagcacg
cgcctgacccgctggcagatcgacgtgaccggcatgctgatcgcgctgcttgaacggctg
gggctcgtatgggacgttcagcacccggaccgggacgcggtgcgcgagcggctcgcgaac
gcacggcgcgacgacgtgtag

DBGET integrated database retrieval system