KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2226Help
Entry
BP1026B_II2226    CDS       T02049                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:bpz00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    BP1026B_II2226
  Lipid metabolism
   00561 Glycerolipid metabolism
    BP1026B_II2226
   00600 Sphingolipid metabolism
    BP1026B_II2226
Enzymes [BR:bpz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     BP1026B_II2226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2768404..2770575)
Genome map
AA seq 723 aa AA seqDB search
MFDTKLIRLTGSNLSIALEKSADMPPVWRYFGAKLEPHAIAWSADDVRPHPPTLLDGDPP
FTAFSTHGFGWFHQPALVGSRPGDVGDIDWAQSFRLDEVSTNDHSVTMKLSDEQAELGAI
LSYTIDPASDVITMWAELENRGATPFRVDWLAAATVPLPPDANRALSFSGRWTLEFQENR
EILGSATWRRDNRRGRTSHDSFPGVMVGSSLADNVGTVYGAHLGWSGNHTIIIEPMTDGR
RQLQLGEWLAPGEVVLAPDQRYRTPCAFLSYSEQGLNGLSAQFHRFVRAKVLRWPRQRMQ
PRPVILNTWEAVYCDHDLEDLKELATAGAQIGIERFVLDDGWFHCRDNDRAGLGDWWPDA
NKYSRGLTPLIHHVRDLDMDFGLWIEPEMVNPDSELYRARPEWTLRLDGRPLVTGRNQLV
LDLAEPDVREYLFTQISALLRDNAISYLKWDMNRDLATAGHRGMPAYRRQTQAFYALLDR
LRAAFPAVEIESCASGGGRADYGVLARMHRLWTSDCNDALTRIGIQRGFLRFFPPELMGA
HIGADRSHTTGRRHTLAFRAAVALFGHLGVEVDPRAMPADEIEALMRWIAIYKEWRPVLH
AGTLHQGCISEALSWTQAVSDDGSASLLAIYRLREDNARYATPLKIKGLRCDIAYRVQTL
YAPVAPHFVKQTQMFKMMQNEGVVISGASLLELGMPIPPMPPESAVVISLKPASELSKPI
DLY
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacaaaacttattcgattgactggttcaaatctcagcatcgcactagagaaa
tcggccgatatgccgcctgtatggcgctattttggcgcaaaattagaaccgcacgccatc
gcctggagcgcagacgacgtgcgaccgcaccctccgacgttactcgacggcgatccgccc
ttcacggcattctcgacacacggattcggctggttccatcaaccggcactcgtcggcagc
cggcctggagacgttggcgatattgactgggcacagagctttcgccttgatgaggtaagc
acaaacgatcactcggtaacaatgaagttgagcgacgaacaggccgagttgggtgcaatc
cttagttacacaatcgatcctgcgtcggacgtcataacgatgtgggctgaattagagaac
cgcggcgcgactccattccgtgtagattggctagccgccgccactgtaccgctgccgccc
gacgcaaatcgggcactgagcttctcggggcgctggacgctggagttccaggaaaatcgt
gaaattctcggttctgcgacgtggaggcgcgacaaccgacgcgggcgcacttctcacgac
tcgtttccgggagtcatggtcggctcatcgctagcggacaatgtgggcaccgtatacggc
gcgcatttgggatggagtggaaaccacaccatcatcatcgaaccgatgaccgatggtcgc
cggcaactgcaattgggggaatggttggcaccgggcgaagtcgtgcttgcaccggaccaa
cgctatcgcacaccatgcgcctttctttcatacagcgagcagggcctgaatggcttgagc
gcgcagttccaccgcttcgttcgggcgaaggtactgcgctggccacggcaacgcatgcaa
cctcggccggtgatcctcaatacttgggaagccgtatattgcgatcacgatctcgaggat
ctcaaggaactggcgactgcgggggcgcagatcggcatcgaacgtttcgttctcgacgac
ggctggttccattgccgcgacaacgatcgcgccggactaggcgactggtggcccgatgcg
aacaagtactctcgcgggctcacaccactcatccatcacgttcgagatttggacatggac
tttggcctatggatcgaacccgaaatggtcaatccggacagcgaattgtaccgcgcccgc
ccggagtggacgcttcggctcgacggtcggccactcgtgacaggtcgcaatcagctcgta
ctggacctcgcggaaccagatgtgcgcgaatatctcttcacgcaaatcagtgctttattg
cgcgacaatgcgatttcctatctcaaatgggatatgaaccgagatctcgccacggctggc
catcgtggcatgcccgcttacaggcgtcagacccaggctttttatgcgttgctcgatcgg
ttgcgcgccgcgttccctgctgtggagatcgagagttgcgcctccgggggcggacgagcc
gattacggcgtgttggctcgcatgcaccgtctctggacgagcgactgcaatgacgcgctc
acgcgcatcggaattcagcgcggctttctgcgtttctttcctcccgagctcatgggtgca
catatcggggccgatcgttcccacacgaccggacgccggcacactcttgctttcagagcc
gcagtcgcacttttcggtcaccttggcgttgaagtcgacccgagagcaatgcccgccgac
gagatcgaagccctcatgcgctggattgcaatatacaaggaatggcggcccgttctacat
gcgggaacccttcaccaggggtgtatcagcgaggcgctctcttggactcaagctgtctcc
gatgacggaagtgcgtcgcttttggcgatctatcgactacgcgaggacaacgcgcgatac
gccacaccactcaagatcaagggactgagatgcgacatcgcctatcgagtacaaacgctc
tacgcacctgtcgcaccacatttcgtgaagcaaacgcaaatgttcaagatgatgcagaac
gaaggcgtggtgatttcgggcgcaagtttgctggagttagggatgccaattcctcccatg
ccgcccgaatccgccgttgtgatttcgctaaaacccgcctcggagttatccaaaccgatt
gatctgtattaa

DBGET integrated database retrieval system