KEGG   Burkholderia pseudomallei 1026b: BP1026B_II2226Help
Entry
BP1026B_II2226    CDS       T02049                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
bpz  Burkholderia pseudomallei 1026b
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:bpz00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bpz00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:bpz00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2:complement(2768404..2770575)
Genome map
AA seq 723 aa AA seqDB search
MFDTKLIRLTGSNLSIALEKSADMPPVWRYFGAKLEPHAIAWSADDVRPHPPTLLDGDPP
FTAFSTHGFGWFHQPALVGSRPGDVGDIDWAQSFRLDEVSTNDHSVTMKLSDEQAELGAI
LSYTIDPASDVITMWAELENRGATPFRVDWLAAATVPLPPDANRALSFSGRWTLEFQENR
EILGSATWRRDNRRGRTSHDSFPGVMVGSSLADNVGTVYGAHLGWSGNHTIIIEPMTDGR
RQLQLGEWLAPGEVVLAPDQRYRTPCAFLSYSEQGLNGLSAQFHRFVRAKVLRWPRQRMQ
PRPVILNTWEAVYCDHDLEDLKELATAGAQIGIERFVLDDGWFHCRDNDRAGLGDWWPDA
NKYSRGLTPLIHHVRDLDMDFGLWIEPEMVNPDSELYRARPEWTLRLDGRPLVTGRNQLV
LDLAEPDVREYLFTQISALLRDNAISYLKWDMNRDLATAGHRGMPAYRRQTQAFYALLDR
LRAAFPAVEIESCASGGGRADYGVLARMHRLWTSDCNDALTRIGIQRGFLRFFPPELMGA
HIGADRSHTTGRRHTLAFRAAVALFGHLGVEVDPRAMPADEIEALMRWIAIYKEWRPVLH
AGTLHQGCISEALSWTQAVSDDGSASLLAIYRLREDNARYATPLKIKGLRCDIAYRVQTL
YAPVAPHFVKQTQMFKMMQNEGVVISGASLLELGMPIPPMPPESAVVISLKPASELSKPI
DLY
NT seq 2172 nt NT seq  +upstreamnt  +downstreamnt
atgttcgacacaaaacttattcgattgactggttcaaatctcagcatcgcactagagaaa
tcggccgatatgccgcctgtatggcgctattttggcgcaaaattagaaccgcacgccatc
gcctggagcgcagacgacgtgcgaccgcaccctccgacgttactcgacggcgatccgccc
ttcacggcattctcgacacacggattcggctggttccatcaaccggcactcgtcggcagc
cggcctggagacgttggcgatattgactgggcacagagctttcgccttgatgaggtaagc
acaaacgatcactcggtaacaatgaagttgagcgacgaacaggccgagttgggtgcaatc
cttagttacacaatcgatcctgcgtcggacgtcataacgatgtgggctgaattagagaac
cgcggcgcgactccattccgtgtagattggctagccgccgccactgtaccgctgccgccc
gacgcaaatcgggcactgagcttctcggggcgctggacgctggagttccaggaaaatcgt
gaaattctcggttctgcgacgtggaggcgcgacaaccgacgcgggcgcacttctcacgac
tcgtttccgggagtcatggtcggctcatcgctagcggacaatgtgggcaccgtatacggc
gcgcatttgggatggagtggaaaccacaccatcatcatcgaaccgatgaccgatggtcgc
cggcaactgcaattgggggaatggttggcaccgggcgaagtcgtgcttgcaccggaccaa
cgctatcgcacaccatgcgcctttctttcatacagcgagcagggcctgaatggcttgagc
gcgcagttccaccgcttcgttcgggcgaaggtactgcgctggccacggcaacgcatgcaa
cctcggccggtgatcctcaatacttgggaagccgtatattgcgatcacgatctcgaggat
ctcaaggaactggcgactgcgggggcgcagatcggcatcgaacgtttcgttctcgacgac
ggctggttccattgccgcgacaacgatcgcgccggactaggcgactggtggcccgatgcg
aacaagtactctcgcgggctcacaccactcatccatcacgttcgagatttggacatggac
tttggcctatggatcgaacccgaaatggtcaatccggacagcgaattgtaccgcgcccgc
ccggagtggacgcttcggctcgacggtcggccactcgtgacaggtcgcaatcagctcgta
ctggacctcgcggaaccagatgtgcgcgaatatctcttcacgcaaatcagtgctttattg
cgcgacaatgcgatttcctatctcaaatgggatatgaaccgagatctcgccacggctggc
catcgtggcatgcccgcttacaggcgtcagacccaggctttttatgcgttgctcgatcgg
ttgcgcgccgcgttccctgctgtggagatcgagagttgcgcctccgggggcggacgagcc
gattacggcgtgttggctcgcatgcaccgtctctggacgagcgactgcaatgacgcgctc
acgcgcatcggaattcagcgcggctttctgcgtttctttcctcccgagctcatgggtgca
catatcggggccgatcgttcccacacgaccggacgccggcacactcttgctttcagagcc
gcagtcgcacttttcggtcaccttggcgttgaagtcgacccgagagcaatgcccgccgac
gagatcgaagccctcatgcgctggattgcaatatacaaggaatggcggcccgttctacat
gcgggaacccttcaccaggggtgtatcagcgaggcgctctcttggactcaagctgtctcc
gatgacggaagtgcgtcgcttttggcgatctatcgactacgcgaggacaacgcgcgatac
gccacaccactcaagatcaagggactgagatgcgacatcgcctatcgagtacaaacgctc
tacgcacctgtcgcaccacatttcgtgaagcaaacgcaaatgttcaagatgatgcagaac
gaaggcgtggtgatttcgggcgcaagtttgctggagttagggatgccaattcctcccatg
ccgcccgaatccgccgttgtgatttcgctaaaacccgcctcggagttatccaaaccgatt
gatctgtattaa

DBGET integrated database retrieval system