KEGG   Bacillus amyloliquefaciens LL3: LL3_00023Help
Entry
LL3_00023         CDS       T01835                                 

Gene name
recR
Definition
recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bql00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LL3_00023 (recR)
DNA repair and recombination proteins [BR:bql03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LL3_00023 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
30093..30689
Genome map
AA seq 198 aa AA seqDB search
MQYPEPISKLIDSFMKLPGIGPKTAVRLAFFVLGMKEDTVLDFAKALVNAKRNLTYCSIC
GHITDQDPCYICEDTRRDKSVICVVQDPKDVIAMEKMKEYNGQYHVLHGAISPMDGIGPE
DIKIPELLKRLQDDQVTEVILATNPNIEGEATAMYISRLLKPSGIKLSRIAHGLPVGGDL
EYADEVTLSKALEGRREL
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgcagtatcctgaaccaatatcaaagctgattgacagctttatgaaattgccagggatc
ggaccgaaaacagcggttcgtctggctttttttgttctaggtatgaaagaagacacagta
ttggattttgctaaggcgcttgtcaatgcgaagcggaatctgacatattgctcgatttgc
ggacatattacagatcaggacccttgttatatatgcgaggatacaagaagagataagtct
gttatttgtgtcgtgcaggaccctaaagatgttattgcaatggagaaaatgaaggaatat
aacggccagtatcatgtgcttcacggcgcgatttctccaatggacggcatcggcccggag
gatattaagattccggaactgctgaagcgccttcaggatgaccaagtgacagaagttatt
ctcgcaaccaaccctaatattgaaggggaagcaacagcgatgtatatatcgaggctgtta
aagccctcaggcatcaagctctcccgtattgcccacggcctgcccgtcggcggcgatttg
gaatatgctgatgaggtcactctttcaaaagcgcttgaaggaagacgtgaattgtaa

DBGET integrated database retrieval system