KEGG   Bacillus amyloliquefaciens LL3: LL3_00048Help
Entry
LL3_00048         CDS       T01835                                 

Gene name
ispE
Definition
(GenBank) 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00900  Terpenoid backbone biosynthesis
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01130  Biosynthesis of antibiotics
Module
bql_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LL3_00048 (ispE)
Enzymes [BR:bql01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     LL3_00048 (ispE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: AEB61603
Position
54603..55481
Genome map
AA seq 292 aa AA seqDB search
MKAMRILEKAPAKINLSLDVTSKRPDGYHEVEMIMTTIDLADRIELTELPENVIRVASHN
RFVPDDQRNLAYQAAKLLKERYQVKKGVSIMITKVIPVAAGLAGGSSDAAATLRGLNRLW
DLKLSVEELAELGAEIGSDVSFCVYGGTALATGRGEKIRHISAPPHCWVVLAKPTIGVST
AEVYRRLNLQQVRHPDVQAMIDAIEEKSFQKVCGQLGNVLESVTLNLHPEVAMIKNQMKR
FGADAVLMSGSGPTVFGLVQYESKVQRIYNGLRGFCDQVYAVRMIGEQNALD
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagctatgcgtattttagaaaaagcgccggccaaaatcaatctgtccctcgatgta
acgagtaaacgcccggatggttatcatgaagtggagatgatcatgacgacaattgatttg
gcagatcggattgaactgacagaactgcccgaaaacgtgatcagagtggcgtcgcataat
cgctttgttcccgatgatcagcggaatctggcttatcaggcagccaaactgctcaaagaa
cggtaccaagtcaaaaaaggcgtttctattatgattacaaaagtgatacctgtagcagca
gggcttgccggcggaagcagcgatgcagcagccacgctcagagggctgaacagactctgg
gatttaaagctttctgttgaagagctcgcggagcttggggctgaaatcggttcagacgtg
tccttctgtgtatacggcggaactgccctggcaacaggacgcggtgagaagatcaggcat
atcagtgctccgcctcattgctgggtcgtgcttgccaaaccgacgattggggtatcgact
gccgaagtgtaccgccggctgaacttgcagcaggttcggcatccggatgtacaagcgatg
attgacgcaattgaagaaaaaagtttccaaaaggtttgcggacaattaggaaacgtattg
gaatcggttacgctcaaccttcatcccgaggtggcgatgattaaaaatcaaatgaaacgc
ttcggcgctgacgcggtgttaatgagcggaagcggaccgactgtattcggtttggttcaa
tacgaatcaaaggtgcagcggatttataacgggttaagaggtttctgtgatcaggtgtac
gcggtgcggatgatcggcgaacagaatgctcttgattaa

DBGET integrated database retrieval system