KEGG   Bacillus amyloliquefaciens LL3: LL3_00079Help
Entry
LL3_00079         CDS       T01835                                 

Gene name
sul
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LL3_00079 (sul)
Enzymes [BR:bql01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     LL3_00079 (sul)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86709..87566
Genome map
AA seq 285 aa AA seqDB search
MAQQTIEQPKLIHTKKGALSYKEKTLIMGILNVTPDSFSDGGKYDSTERALLHAAKMAEE
GAHIIDIGGESTRPGASLVSADEEMSRVIPAIERITSELDVPISIDTYKASVADEAVKAG
ASIINDIWGAKGDPDMASVAAAHSVPIILMHNRKERNYNDLIPDMLADLMESVKIAAEAG
VSDENMILDPGIGFAKSYEDNLAVMNKLEVFSGLGYPLLLATSRKRFIGRVLDLPPEERA
EGTGATVCLGVQKGCDIVRVHDVKQIARMTKMMDAMLNKGGAHHG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagcaaacaattgaacagcctaaactgattcatacaaaaaaaggcgctctgtcc
tataaagagaagacactcattatggggatattaaatgtaacgccagactccttctctgac
ggcggtaaatacgacagtacggaaagagcgcttctccatgcggcgaagatggctgaagaa
ggggcgcacatcatagatatcggcggagaatcgacaaggcccggcgcatcactcgtgtcg
gctgatgaggaaatgtcacgtgtaatccccgccatagagcggatcacaagcgaactggac
gttccgatttcaattgatacgtacaaagcgtccgtagcagacgaagcggtcaaagcgggg
gcctccatcattaatgacatctggggggcgaaaggtgatcctgacatggcgtcagtagcc
gccgcacacagtgttccgattatcttaatgcataatcgcaaggagagaaactataacgat
ctgattcctgatatgctcgcagatttgatggaaagtgtaaaaattgccgcagaagccggc
gtttcagatgaaaacatgattctggatccggggatcggcttcgcgaaaagctatgaggac
aatctggctgtcatgaacaagctggaagtgttcagcgggttagggtatccgctgctcctc
gcgacatcgagaaaaagattcatcggccgtgtgcttgaccttcctcctgaagaacgtgcc
gaggggacgggagcgacggtatgccttggcgtccagaaaggctgcgacattgtgagggtg
cacgatgtcaagcagatcgcgagaatgactaagatgatggatgctatgttgaataaagga
ggcgcacatcatggataa

DBGET integrated database retrieval system