KEGG   Bacillus amyloliquefaciens LL3: LL3_00169Help
Entry
LL3_00169         CDS       T01835                                 

Gene name
ybbD
Definition
beta-hexosaminidase lipoprotein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bql00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:bql00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(174885..176795)
Genome map
AA seq 636 aa AA seqDB search
MKLVISAVLLLFIVSGTHHASTKPDIPSQAEQAVSRMTLDEKLGQMLMPDFRNWQKKGQS
SPQALTQMNDEVAGLIQKYRFGGVILFAENVKSTEQTVRLTDAFQKASPDIPLLLSIDQE
GGIVTRLGEGTHFPGNMALGAARKTAYASQTGAIIGKELKALGINTNFAPVLDINNNPGN
PVIGVRSFSSDRDLTASLGLASMKAQQKQDVAAAVKHFPGHGDTDVDSHYGLPLVTHSQE
RLRQIELYPFRKAIQAGADMIMTAHVQFPAFDDTTYKSKLDGSDILVPATLSKKVMTHLL
REEMGFNGVIVTDALNMKAIADHFGQEEAVVMAVKAGVDIALMPAQVTSLQTENRFAQVL
AALKKAVQKGEIPVQQINKSAERIISLKIKRGIYPAKETSLNKKVAKAKQTVGSKNHLKA
EKQIAERSVTVLQNKNRTLPFKPKKNSRVLIAAPYEDQTASMEQTIRQLIKKKEIRPVTI
SKMNFAERTFNDEYKKLVSDADYVITGSYVVKNDPVVNDGTIDDSVTDPGKWTTAFPRAV
MKSAQSNHKPFVLMSLRNPYDAANFEEAEALIAVYGFKGYADGQFLQPNIPAGIEAIFGQ
TKPKGRLPVDIPSVTHPGTTLYPYGFGINLKNGKPL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgtcatctcagctgtattactgttgttcattgtttccggcacacatcatgca
tcgacaaaaccggacattccgtcacaggcggaacaagcggtatcccgcatgacattagat
gaaaaactggggcagatgctcatgcctgattttcgaaattggcaaaagaaggggcagtca
tcccctcaggctcttacccaaatgaatgacgaagtcgcagggcttattcaaaagtaccgg
ttcggcggcgttatcttatttgcagaaaatgtaaaaagcactgagcaaacggtccgcctg
acagatgcctttcaaaaggcgagccctgatattccacttttattaagcattgatcaagaa
ggcggcatcgtaacaagacttggtgaaggcactcatttcccaggcaatatggcactcgga
gccgcgagaaaaacagcttacgcgtcccagaccggcgccataatcgggaaagaactgaag
gcacttggcattaatacgaatttcgctcccgttctcgatatcaataataatcccggaaat
ccggtcatcggcgtcaggtcattcagttcagaccgtgatctgacagcatcactcggcctt
gcctcaatgaaggctcagcaaaaacaggatgtcgctgccgccgtcaaacatttcccggga
cacggcgatacggatgtcgacagccactacggcctcccgcttgtcacccacagtcaagaa
aggctgcgtcagattgaactttatccgttccggaaagccattcaggccggggccgatatg
atcatgacagcccatgtgcaatttcccgcttttgacgatacaacttataaaagcaaactg
gacggttcagacatcctcgtacccgccacactctcgaaaaaagtgatgactcatcttctc
cgtgaggaaatgggatttaacggcgtcattgtcacggatgcattaaatatgaaagccatt
gccgatcatttcggccaggaagaggcggtcgtcatggccgtaaaagcaggagtggatatc
gctctgatgccggcccaagtgacatcgctgcaaacggaaaaccgctttgcccaagttctt
gccgctttaaaaaaggcggttcagaaaggggaaataccggttcagcaaattaacaaatcg
gcggaacgcatcatttccctgaaaataaaaagaggtatatatcccgcgaaagaaacaagt
ctgaataagaaggtcgcaaaagcaaagcaaaccgtcggaagcaaaaaccatctgaaagct
gaaaaacaaatcgcggaaagatccgtcaccgtcttacaaaacaaaaaccgtacccttcca
ttcaaaccgaaaaagaacagccgcgttctcattgccgctccttatgaagatcaaacagca
tccatggaacaaaccatccggcagctcatcaagaagaaagagatccggccggtaaccatc
agtaaaatgaacttcgccgagcgcacatttaatgatgagtataaaaagctcgtatccgac
gccgattacgtcattacaggctcatatgtcgtgaaaaatgaccctgtcgtaaatgacggc
accattgacgattctgtcacagatcccggcaagtggacgaccgcatttccgcgggccgtc
atgaaatccgcacaatcgaaccataaaccctttgtgctgatgagccttcgtaatccttac
gacgccgctaattttgaagaagctgaagcccttattgcagtctacggctttaaaggatat
gcagacggacaatttcttcagccaaacattccggcaggcattgaagcgatattcggacag
acaaaaccgaaaggcaggctgcccgttgacattccttccgtcactcacccgggaacgacg
ctgtacccttatggcttcggaattaatctaaaaaacggaaaaccgctttaa

DBGET integrated database retrieval system