KEGG   Bacillus amyloliquefaciens LL3: LL3_00745Help
Entry
LL3_00745         CDS       T01835                                 

Gene name
yetO
Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:bql00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:bql00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:bql00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
703997..707182
Genome map
AA seq 1061 aa AA seqDB search
MKETSPIPKPKTFGPLGNLPLLDKDKPTMSLIKLAKEQGPIFQLHTPAGTIIVVSGHELV
KEVCDEERFDKSIEGALEKVRAFSGDGLFTSWTHEPNWRKAHNILMPTFSKRAMKDYHSM
MTDIAVQLIQKWARLNPDEAVDVPADMTRLTLDTIGLCGFNYRFNSYYRETPHPFINSMV
RALDEAMHQMQRLDVQDKLMIRTKRQFHHDIQAMFSLVDSIIAERRSDGGRDEKDLLARM
LNVEDPETGEKLDDENIRFQIITFLIAGHETTSGLLSFAIYFLLKHPRVLEKAYEEADRV
LTDPVPSYKQVLELTYIRMILQESLRLWPTAPAFSLYAKEDTVIGGKYPITTKDRISVLI
PQLHRDKDAWGDNAEEFYPERFEHPDQVPHHAYKPFGNGQRACIGMQFALHEATLVLGMI
LQHFTFTDHTDYELDIKQTLTLKPNDFHIRVRPRSKEAVPAAFTAAEKAAEDVTKEKQET
KGASIIGLDNRPLLILYGSDTGTAEGVAWELADTAGMHGVRTETAPLNDRIGKLPKEGAL
LIITSSYNGKPPSNAGQFVQWLEEVKQGELEGVRYAVFGCGDHNWAATYQAVPRLIDEKL
AEKGAERFSSRGEGDVSGDFEGKLDEWKKSMWKDAMKAFGLKLNENAEKERSTLGLQFVS
GLGGSPLAQTYEAVYASVAENRELQAPESDRSTRHIEIILPKEAAYNEGDHLGVLPVNSK
EQVSRVLRRYNLNGNDQVLLTASGQSAAHLPLDRPVRLHDLLSSCVELQEAASRAQIREM
AAYTVCPPHKHELEGLLEEGVYQEQILTLRVSMLDLLEKYEACELPFERFLELLRPLKPR
YYSISSSPLKHPGQASITVGVVRGPARSGLGEYRGVASNYLADRSPDDGIVMFVRTPETK
FRLPEDPEKPIIMVGPGTGVAPFRGFLQARAALKGEGKELGEAHLYFGCRNDYDFIYRDE
LEAYEKDGIVTLHTAFSRKEGVPKTYVQHLMAEDAETLISILDRGGHLYVCGDGSKMAPD
VEETLQKAYQSAHGTDERQAQEWLLDLQTKGIYAKDVWAGI
NT seq 3186 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaacaagtccgattccgaagccgaagacgttcgggccgctcggcaatctccct
ttgcttgataaagacaagcccacaatgtcgcttatcaaactggccaaagagcaggggccc
atttttcagctgcatacaccggcgggcaccattatcgtcgtgtccggccatgaactggtg
aaagaggtttgtgacgaagagcggtttgataaaagtattgaaggggctttggaaaaagtc
cgcgcgttttccggtgacgggctgtttacaagctggacgcacgagcctaactggcgaaag
gcgcacaatattctgatgccgaccttcagcaagcgcgcgatgaaagattatcattcgatg
atgactgatatcgcggtgcagctgattcaaaaatgggcaaggctgaatcctgatgaggcc
gttgatgtgcctgctgatatgacccggctgacgctcgatacgatcggactgtgcggtttt
aactatcggtttaacagctattacagagaaacgcctcatccgtttattaacagcatggtg
cgcgcacttgatgaagcgatgcaccaaatgcagcgtcttgatgttcaggataagctcatg
atcaggacgaagcgccaatttcatcatgatattcaggcgatgttttcgttggtagacagt
attatcgcagagcgcaggtcagacggcggccgggatgaaaaagatctgctggccaggatg
ctgaatgttgaagacccggaaacaggtgaaaaacttgatgatgaaaatatccgctttcaa
atcatcacgtttttaattgccggccatgaaacgacaagcggcctgctttcctttgccatc
tactttctgctgaagcatccccgcgttttggaaaaagcttatgaggaagctgatcgggta
ttgaccgatcccgttccttcgtataaacaagtgctggagcttacctatatccggatgatt
ttgcaggagtcattgcgcttatggccgaccgcgcctgcgttcagtctttatgcgaaagag
gatacggtgatcggcgggaaatatccgatcacgacaaaagacagaatttccgtcttaatt
cctcagcttcatcgtgataaagacgcgtggggagacaatgcggaggaattttatccggag
cggtttgaacatcctgatcaagtgccccaccatgcgtacaagccgttcggaaacggtcag
cgggcgtgtatcggcatgcagttcgcgctgcatgaagcgactcttgtactggggatgatt
cttcagcattttacctttacagaccataccgattatgagctggatattaaacagacgtta
acgctcaagcccaacgactttcatatccgggtgcggccgcggagcaaagaagccgttccg
gcggctttcacggcggctgaaaaagcggcggaagacgtaacaaaagaaaaacaggagaca
aaaggcgcttccattatcgggcttgacaaccgaccgcttctgattctgtacggctcagat
acgggaaccgcagaaggcgttgcgtgggagcttgccgatactgccgggatgcacggcgtc
cggactgaaacggcacctttgaatgaccggatcggaaaattgccgaaagaaggagctctc
ttgatcattacgtcctcttataacggaaagcctccgagtaacgccggacaattcgttcaa
tggcttgaagaagtcaaacaaggggaattggaaggcgtccgatatgccgtcttcggctgc
ggtgatcataactgggcggcgacatatcaggccgttccgagacttattgatgaaaagctt
gctgaaaaaggggcggaacgcttttcctcacgaggtgaaggtgatgtcagcggcgatttt
gaaggaaagcttgatgaatggaaaaaaagtatgtggaaggacgccatgaaagcgttcggt
ctcaagctgaatgaaaatgccgaaaaagagcggagtacgctgggccttcaatttgtgagc
gggcttggcggctctcccttggctcagacgtatgaagcggtttacgcatccgttgcggaa
aacagggagctccaagcgccggaaagcgatagaagcacaaggcatattgaaatcattctg
ccgaaggaggctgcttacaatgaaggggatcatctcggcgttctgcctgtaaacagcaaa
gagcaggtcagccgtgttctccgccggtacaatctgaacggcaacgaccaagtgctgctg
acggccagcggacagagcgcggctcatctcccgctcgatcggccggtcaggctgcacgat
cttctgagcagctgcgtcgaattgcaggaagcggcatcaagagctcaaatccgtgaaatg
gccgcttatactgtctgcccgccgcacaaacatgaattggaaggtcttcttgaggagggt
gtctatcaggagcaaatcctgacattgcgcgtctcaatgctcgatctccttgaaaaatat
gaagcgtgtgagcttccgtttgaacgatttttggagcttttgcgtccgctgaaaccgcgt
tattattcgatttcaagctcgccgctgaaacatcccgggcaggcttcaattaccgtcggc
gtcgttcgcggccccgcccgcagcggtttgggggagtatcgcggagtcgcttcgaactat
ttggcggatcgcagtcctgacgatggtatcgtgatgtttgtccgcacgccggaaacaaaa
ttccggcttccggaagatccggaaaaaccgattattatggtcggtccgggcacaggagtc
gccccgttccgcggatttttgcaggcgcgggcggcattaaaaggagaaggaaaagagctg
ggggaggcccatctctacttcggatgcagaaacgattatgattttatttaccgtgacgag
cttgaagcttatgaaaaagacggaatcgtgacgcttcatacggctttctcccgcaaagaa
ggcgtaccgaaaacgtatgtgcagcacttaatggcggaagatgccgaaactttaatttcg
atccttgacaggggagggcatctatacgtatgcggcgacggaagcaagatggcgcctgat
gtagaggaaacgctgcaaaaagcatatcagtcggctcacggaacagatgaacggcaagca
caagagtggcttttggatctccagacaaaaggcatttatgcaaaagatgtctgggcggga
atttaa

DBGET integrated database retrieval system