KEGG   Bacillus amyloliquefaciens LL3: LL3_00839Help
Entry
LL3_00839         CDS       T01835                                 

Gene name
acoC
Definition
(GenBank) acetoin dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00010  Glycolysis / Gluconeogenesis
bql00020  Citrate cycle (TCA cycle)
bql00620  Pyruvate metabolism
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
Module
bql_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_00839 (acoC)
   00020 Citrate cycle (TCA cycle)
    LL3_00839 (acoC)
   00620 Pyruvate metabolism
    LL3_00839 (acoC)
Enzymes [BR:bql01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     LL3_00839 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N HlyD_3 HlyD_D23 PYNP_C GCV_H EF_TS
Motif
Other DBs
NCBI-ProteinID: AEB62384
Position
815365..816558
Genome map
AA seq 397 aa AA seqDB search
MAVKVVMPKLGMAMKQGEVSVWNKKVGDPVEKGESIASINSEKIEMEVEAPESGTLLHIK
VKEGEGVPPGTAICYIGENGEKVQEKEAPAPENAGEPQAEPETIPAPKAGKERKHRVKIS
PVARKMAEKAGLKVDTLNGTGPGGRIVKADVIKAMKTEAEPRSSVQTAQPEGKPASAMRK
VIADRMHKSLQNSAQLTLTMKADITELVKWQKQLADSAKKRSGVKLTVTHFVSRAAVLAL
KQHPELNSSYQEERIITYPHVHLGMAVSLENGLVVPVIRDAEKLSFLELADQISTSARRA
REGNASGDDLHGSTFSITNLGGYGIEHFTPILNPPEAGILGVGASYETPAFKGDELVKST
VLPLSLTFDHRVCDGAPAADFLKTVKALLEEPAGLIL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggctgtaaaagtagtaatgccgaaattgggaatggcgatgaagcaaggtgaagtatca
gtctggaataagaaagtcggcgatccggttgaaaagggagaaagcatcgccagcatcaac
tctgaaaaaatagaaatggaagtagaagcgcccgaaagcggcacgctccttcacattaaa
gtcaaagagggagaaggagttccgccgggaacggccatctgttatatcggggaaaacggt
gaaaaggtgcaggagaaggaggcaccggcccctgaaaatgccggggaaccacaagcagaa
cctgaaactattcccgctcccaaagccgggaaagagcgtaaacaccgcgtgaaaatatcc
cctgtggcccgaaaaatggcggagaaggcaggattgaaagttgatacgctgaacgggacg
gggcccgggggcagaatcgtaaaagccgacgtcataaaggcgatgaagacggaagctgaa
ccgcggtcttcggttcagacggcacagccggagggaaaaccggcctcagcaatgagaaaa
gtgattgcagaccgaatgcacaaaagcctgcaaaacagcgcccagctgacactgaccatg
aaagcggacattacggagcttgtgaaatggcagaaacagctggccgacagtgcgaaaaag
cggagcggtgttaaactgacggtcacgcattttgtatcccgggccgcggtgcttgcgctg
aaacagcatcctgagctgaacagctcttatcaagaggagcggatcattacctatccgcat
gtccatctcgggatggcagtttctcttgaaaacggccttgtcgtgccggtgatccgtgat
gcggaaaagctttcattccttgagcttgcggatcaaatcagcacatctgcacgccgggcg
cgggaaggaaatgcttccggagatgatcttcacgggtcgactttttctattacaaatctc
gggggatatggaattgaacatttcaccccgatccttaatccgcctgaagccggtattctc
ggagtgggcgcaagctatgaaacgccggcgttcaaaggagatgagcttgtcaaaagcacc
gtgctgccgctgagcctcacctttgatcacagagtatgtgacggtgctccggctgcggac
ttcctgaaaacggttaaagcgctgcttgaagagccggccggattgattttatag

DBGET integrated database retrieval system