KEGG   Bacillus amyloliquefaciens LL3: LL3_01010Help
Entry
LL3_01010         CDS       T01835                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:bql00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
963599..965089
Genome map
AA seq 496 aa AA seqDB search
METYILSIDQGTTSSRAILFNKEGKIVHSAQKEFTQHFPQPGWVEHNANEIWGTVLAVIA
TVISESGISADQIAGIGITNQRETTVVWDKDTGKPIYNAIVWQSRQTSGICEELREKGYS
DTFRQKTGLLIDPYFSGTKVKWILDNVEGAREKAENGNLLFGTIDSWLIWKMSGGAAHVT
DYSNASRTLMFNIHELKWDDELLDILGVPKSMLPEVKPSSHVYAKTVDYHFFGKNIPIAG
AAGDQQSALFGQACFEEGMGKNTYGTGCFMLMNTGEKAITSEHGLLTTIAWGLDGKVEYA
LEGSIFVAGSAIQWLRDGMRMFQDSKESETYAERVDSTDGVYVVPAFVGLGTPYWDSDVR
GSVFGLTRGTTKEHFIRATIESLAYQTKDVLDAMEADSGISLKTLRVDGGAVKNNFLMQF
QSDLLDVPVERPQINETTALGAAYLAGIAVGYWKDSAEIADQWNLDKQFKPDMEDEKREE
LYSGWKKAVNAAMAFK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggagacctatattttatcaattgaccaaggcacaacaagctcaagagcgattcttttt
aataaagaaggaaaaatcgtgcattccgctcaaaaggaattcacacagcatttccctcag
ccgggctgggtggagcacaatgcgaacgaaatctggggaacggtgctcgctgttatcgcg
actgttatctccgagtccgggatcagcgctgatcaaattgccggaatcggcatcacgaac
caaagggaaacgacggtcgtatgggataaagacaccggaaagccgatatacaatgcgatt
gtatggcagtccagacaaacatccggcatttgcgaagagcttcgtgaaaaaggatacagt
gatacattcagacaaaaaacggggcttctgatcgacccttatttctcaggaacaaaagtc
aaatggattcttgacaatgtagaaggcgcccgggaaaaagcggaaaacggaaatcttctg
ttcggaacgattgattcatggctcatctggaaaatgtccggaggcgcggcacacgtaacg
gattattccaatgcctcaagaacgctgatgtttaatattcatgaattaaaatgggatgat
gaactgcttgatattttaggcgtgccgaaatccatgctgcctgaagtgaaaccgtcttct
catgtatacgcgaaaacggttgattatcatttcttcggtaaaaatattccgattgcgggg
gcggcaggagatcagcagtcagcgctgttcggtcaggcgtgctttgaagaaggcatgggg
aaaaacacatacggcacaggctgctttatgctcatgaataccggtgaaaaagccattact
tcagagcacggcctgctgacgacaattgcctggggattagacggaaaagttgagtatgcg
ctggaaggaagcatctttgtcgctggttctgccatccaatggctgagagacggcatgcgg
atgttccaggattcgaaagaaagcgagacatacgcagagcgtgtggattccactgacggt
gtttatgtcgtgcctgcttttgtcggattaggcacaccgtactgggatagtgacgtgcgc
ggctcagtcttcggcctgacacgcggaacgacgaaggagcattttatccgtgctacgatt
gaatcgctcgcatatcagacgaaagatgttcttgacgccatggaggctgattcaggcatc
tctttgaaaacattgcgtgtagacggcggagcggtaaaaaataatttccttatgcagttc
caaagcgacttgcttgatgttccggtcgaacgtccgcaaattaatgaaacgacggcgctc
ggtgccgcatatttagccggaattgctgtcggctactggaaggacagcgctgaaatcgct
gatcaatggaatctggataagcaattcaaaccggatatggaagatgaaaaacgcgaagaa
ttgtacagtggctggaaaaaagcagtaaatgcagctatggcttttaaataa

DBGET integrated database retrieval system