KEGG   Bacillus amyloliquefaciens LL3: LL3_01118Help
Entry
LL3_01118         CDS       T01835                                 

Gene name
aprE
Definition
Subtilisin BPN
Orthology
K01342  
subtilisin [EC:3.4.21.62]
Organism
bql  Bacillus amyloliquefaciens LL3
Brite
Enzymes [BR:bql01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.62  subtilisin
     LL3_01118 (aprE)
Peptidases [BR:bql01002]
 Serine Peptidases
  Family S8: subtilisin family
   LL3_01118 (aprE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(1061217..1062365)
Genome map
AA seq 382 aa AA seqDB search
MRGKKVWISLLFALALIFTMAFGSTSSAQAAGKSNGEKKYIVGFKQTMSTMSAAKKKDVI
SEKGGKVQKQFKYVDAASATLNEKAVKELKKDPSVAYVEEDHVAHAYAQSVPYGVSQIKA
PALHSQGYTGSNVKVAVIDSGIDSSHPDLKVAGGASMVPSETNPFQDNNSHGTHVAGTVA
ALNNSIGVLGVAPSASLYAVKVLGADGSGQYSWIINGIEWAIANNMDVINMSLGGPSGSA
ALKAAVDKAVASGVVVVAAAGNEGTSGSSSTVGYPGKYPSVIAVGAVDSSNQRASFSSVG
PELDVMAPGVSIQSTLPGNKYGAYNGTSMASPHVAGAAALILSKHPNWTNTQVRSSLENT
TTKLGDSFYYGKGLINVQAAAQ
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
gtgagaggcaaaaaagtatggatcagtttgctgtttgctttagcgttaatctttacgatg
gcgttcggcagcacatcctctgcccaggcggcagggaaatcaaacggggaaaagaaatat
attgtcgggtttaaacagacaatgagcacgatgagcgccgctaagaagaaagatgtcatt
tctgaaaaaggcgggaaagtgcaaaagcaattcaaatatgtagacgcagcttcagctaca
ttaaacgaaaaagctgtaaaagaattgaaaaaagacccgagcgtcgcttacgttgaagaa
gatcacgtagcacatgcgtacgcgcagtccgtgccttacggcgtatcacaaattaaagcc
cctgctctgcactctcaaggctacactggatcaaatgttaaagtagcggttatcgacagc
ggtatcgattcttctcatcctgatttaaaggtagcaggcggagccagcatggttccttct
gaaacaaatcctttccaagacaacaactctcacggaactcacgttgccggcacagttgcg
gctcttaataactcaatcggtgtattaggcgttgcgccaagcgcatcactttacgctgta
aaagttctcggtgctgacggttccggccaatacagctggatcattaacggaatcgagtgg
gcgatcgcaaacaatatggacgttattaacatgagcctcggcggaccttctggttctgct
gctttaaaagcggcagttgataaagccgttgcatccggcgtcgtagtcgttgcggcagcc
ggtaacgaaggcacttccggcagctcaagcacagtgggctaccctggtaaatacccttct
gtcattgcagtaggcgctgttgacagcagcaaccaaagagcatctttctcaagcgtagga
cctgagcttgatgtcatggcacctggcgtatctatccaaagcacgcttcctggaaacaaa
tacggggcgtacaacggtacgtcaatggcatctccgcacgttgccggagcggctgctttg
attctttctaagcacccgaactggacaaacactcaagtccgcagcagtttagaaaacacc
actacaaaacttggtgattctttctactatggaaaagggctgatcaacgtacaggcggca
gctcagtaa

DBGET integrated database retrieval system