KEGG   Bacillus amyloliquefaciens LL3: LL3_01121Help
Entry
LL3_01121         CDS       T01835                                 

Gene name
yhfS
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LL3_01121 (yhfS)
   00630 Glyoxylate and dicarboxylate metabolism
    LL3_01121 (yhfS)
   00640 Propanoate metabolism
    LL3_01121 (yhfS)
   00650 Butanoate metabolism
    LL3_01121 (yhfS)
  Lipid metabolism
   00071 Fatty acid degradation
    LL3_01121 (yhfS)
   00072 Synthesis and degradation of ketone bodies
    LL3_01121 (yhfS)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LL3_01121 (yhfS)
   00310 Lysine degradation
    LL3_01121 (yhfS)
   00380 Tryptophan metabolism
    LL3_01121 (yhfS)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LL3_01121 (yhfS)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LL3_01121 (yhfS)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LL3_01121 (yhfS)
Enzymes [BR:bql01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LL3_01121 (yhfS)
Exosome [BR:bql04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LL3_01121 (yhfS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1064334..1065425)
Genome map
AA seq 363 aa AA seqDB search
MEAVITDAKRTIFARENGLLKDCLPENLAAPLIRYLSRNMAEDIDEVLIGNATGRGGNLA
RLSALTAGLPLSVPGTTIDRQCGSGLDAMRIACHFVKAGAGSTYIAGGAESSSRSPFSSR
ARFSPEHIGDPDMGIAAEYTAQAYAVTRKMQDEYALLSYERSFKAHEDGLYRQEILPCHG
FAADENMLKKRNMEPLIARAKPVFQSGGSVTAANSCGISDGAAAVCVMEEQKARSLGLKP
KLRFIGSTVSGVHPHYPSAAPVYAVKKLLKEQNLSPDDIDIYEINEAFAVKICVFSQQLQ
VPYSKINVRGGALAVGHPYGASGAALVSRLFYEAKRRPDARYAAAAIGSGGGVGLALLFE
VLT
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaagctgtaattacggatgcgaaacgaacgattttcgcccgggaaaacggcctgtta
aaagattgtcttcctgaaaatttagcagctccgctgatccgctatttgagccggaacatg
gcagaagacattgatgaagttctgatcggaaatgcgacaggccgcggcgggaacctcgcc
cggctatcagccttgacggccgggcttcctttgagcgtgcctgggacgaccatcgacaga
cagtgcggttccgggctggacgccatgagaatcgcgtgccattttgtaaaagccggcgcg
gggagcacgtacatcgcgggaggagcggagagcagcagccgctcccctttttcttcccgc
gcgcgtttttcacctgaacatatcggcgatcctgatatgggcatagcagccgagtatacg
gcacaggcttacgcagtcacgagaaaaatgcaggacgaatatgccctcctcagctatgaa
cggagcttcaaagcgcacgaagacggcctgtaccgacaggaaatcctcccgtgtcacgga
ttcgccgctgacgaaaacatgctgaaaaagcggaacatggaacctcttatcgcccgcgcc
aaacccgtctttcagtccggcggctctgtcaccgccgccaacagctgcggcatttctgac
ggggcggcggcggtttgtgtaatggaagaacaaaaagcgcggtccctcggtttaaaaccg
aaattgcgttttatcggaagcacggtaagcggcgtccatccgcattatccgtcagcagct
ccggtttatgccgtcaaaaagcttttgaaggagcagaacctgtcaccggatgatattgat
atatacgaaatcaacgaggcgtttgccgtcaaaatatgcgtcttttcacaacagcttcaa
gtgccatattctaaaataaatgtccggggcggcgctctagccgtcgggcatccgtacggg
gcttccggggcggcgcttgtctcccggcttttttatgaagcaaaaagacggccggatgcc
cgctacgcagcagcagcgatcggcagcgggggcggagtcggactggcgcttctctttgaa
gtgttaacgtaa

DBGET integrated database retrieval system