KEGG   Bacillus amyloliquefaciens LL3: LL3_01319Help
Entry
LL3_01319         CDS       T01835                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00860  Porphyrin and chlorophyll metabolism
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LL3_01319 (hemD)
Enzymes [BR:bql01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LL3_01319 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Acyl-thio_N
Motif
Other DBs
NCBI-ProteinID: AEB62860
Position
1240359..1241216
Genome map
AA seq 285 aa AA seqDB search
MGRPASEGKKKTAMGKGLNGKRIAIGGSRKTEEITRLIEKQGGTAVVRSLQGTVYLAEEQ
IEPDVRTFAEQKADWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEANIGCRGYKTYAAL
KKLGVTPHASDEDGTTRGLIRSLERFELKDKKVMIQLHGEKAPVLTEFLEKNGAEVFPVL
PYQHIPPERETVDKMLGELLNGEVDAVCFTTAIQVRSLFDYAKEKGSAKELQQAFETHVL
AAAVGKVTAEAIRDEGVNRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcccggcatctgaagggaagaaaaaaacagcgatgggaaaaggattgaacgga
aaacggattgcgatcggcggttcgcggaaaacagaagagatcacgagattaatagaaaag
cagggcggaacggcagttgtccgttccctccaaggaaccgtatacctggcggaggaacag
attgaacccgacgtaagaacatttgctgagcaaaaagccgactgggtgatattcaccacc
ggcatcggtacggaaacgttattgtcagtatcggaaaaaatcggtctgaaagaagaattt
ttagcggccgttcatgaagcgaatatcggctgcaggggctataaaacatatgcggcctta
aaaaagctcggcgtcacgccgcatgcttcagatgaagacggtacgacaagaggcctgatc
cgctccttggaacggtttgaattgaaagacaaaaaagtcatgatccagcttcacggggaa
aaagcgcccgtcttaacggaattccttgagaaaaacggagcggaggtattccctgttctg
ccttatcagcatattccgcctgaaagggagacggtcgataaaatgctgggagagctgtta
aacggcgaggtcgacgccgtatgttttacgactgccattcaagtgcgttctctctttgat
tatgcaaaagaaaaagggtctgcaaaagaattgcagcaagcattcgaaacacatgtactt
gccgccgcagtcggcaaagtgacggctgaagcgatccgggatgaaggggtgaatagagtc
cttgctccggacatcgagcggatgggagcgatgattatcgagttatcccgttactatgaa
tctctgaccttatcataa

DBGET integrated database retrieval system