KEGG   Bacillus amyloliquefaciens LL3: LL3_01319Help
Entry
LL3_01319         CDS       T01835                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    LL3_01319 (hemD)
Enzymes [BR:bql01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     LL3_01319 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1240359..1241216
Genome map
AA seq 285 aa AA seqDB search
MGRPASEGKKKTAMGKGLNGKRIAIGGSRKTEEITRLIEKQGGTAVVRSLQGTVYLAEEQ
IEPDVRTFAEQKADWVIFTTGIGTETLLSVSEKIGLKEEFLAAVHEANIGCRGYKTYAAL
KKLGVTPHASDEDGTTRGLIRSLERFELKDKKVMIQLHGEKAPVLTEFLEKNGAEVFPVL
PYQHIPPERETVDKMLGELLNGEVDAVCFTTAIQVRSLFDYAKEKGSAKELQQAFETHVL
AAAVGKVTAEAIRDEGVNRVLAPDIERMGAMIIELSRYYESLTLS
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggggcgcccggcatctgaagggaagaaaaaaacagcgatgggaaaaggattgaacgga
aaacggattgcgatcggcggttcgcggaaaacagaagagatcacgagattaatagaaaag
cagggcggaacggcagttgtccgttccctccaaggaaccgtatacctggcggaggaacag
attgaacccgacgtaagaacatttgctgagcaaaaagccgactgggtgatattcaccacc
ggcatcggtacggaaacgttattgtcagtatcggaaaaaatcggtctgaaagaagaattt
ttagcggccgttcatgaagcgaatatcggctgcaggggctataaaacatatgcggcctta
aaaaagctcggcgtcacgccgcatgcttcagatgaagacggtacgacaagaggcctgatc
cgctccttggaacggtttgaattgaaagacaaaaaagtcatgatccagcttcacggggaa
aaagcgcccgtcttaacggaattccttgagaaaaacggagcggaggtattccctgttctg
ccttatcagcatattccgcctgaaagggagacggtcgataaaatgctgggagagctgtta
aacggcgaggtcgacgccgtatgttttacgactgccattcaagtgcgttctctctttgat
tatgcaaaagaaaaagggtctgcaaaagaattgcagcaagcattcgaaacacatgtactt
gccgccgcagtcggcaaagtgacggctgaagcgatccgggatgaaggggtgaatagagtc
cttgctccggacatcgagcggatgggagcgatgattatcgagttatcccgttactatgaa
tctctgaccttatcataa

DBGET integrated database retrieval system