KEGG   Bacillus amyloliquefaciens LL3: LL3_01707Help
Entry
LL3_01707         CDS       T01835                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bql00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bql00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1580991..1581905
Genome map
AA seq 304 aa AA seqDB search
MNHLTAMSELSTAEITELLREAKAIKEGTECPDLSGKFVANLFFEPSTRTRFSFEVAEKK
LGMNVLNLDGTSTSVQKGESLYDTIKTLEAIGADACVIRHSTDEYYKDLTGKVNIPILNA
GDGCGQHPTQSLLDLMTIQEEFENFQGLTVSIHGDIKHSRVARSNAEVLTRLGARVLFSG
PPQWQDENNSFGTCVQTDEAIQASDVVMLLRIQNERHQTEADQKGYLEAYGLTAKRAESM
KRHAIIMHPAPVNRGVEIDTILVESGKSRIFKQMENGVYIRMAVLKRALQTNAKRGEAAY
VLSH
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaatcatttaacggcgatgtctgaactgagcacggctgaaattacagaattgctgcgt
gaggcaaaagcgataaaagagggaacagagtgccccgatctctcgggaaaattcgttgcg
aatctgttttttgaaccaagcacgagaacgcggttcagctttgaagtggcggaaaaaaag
ctcggtatgaacgtgctcaatttagacggcacgagtacaagcgttcaaaaaggcgagtct
ttatacgacacgatcaaaacactggaagcaatcggagcggacgcctgcgtcatcaggcac
agcacggatgaatattacaaggatctgactggcaaagtaaatattccgatcttaaatgcg
ggcgacggctgcggccagcatccgacccaatcattgctcgatctaatgacgattcaagag
gaatttgagaattttcagggtctgaccgtttccattcatggcgatatcaaacacagcagg
gtggcaaggtcaaatgccgaggtgctgacaaggctcggcgcacgcgtgctgttttctggt
ccgccgcaatggcaggatgagaacaactccttcggcacctgtgttcagacggatgaagcc
atacaagcttcagatgtcgtcatgctgctccgcattcaaaatgaaagacatcagacagaa
gcggaccaaaaaggctacctggaagcatacgggctgaccgcaaagcgtgcggaaagcatg
aagcggcatgccatcatcatgcatcccgcaccggtaaacagaggggtcgaaattgacaca
atattagtggaatccggaaaatcacgaatatttaaacaaatggaaaatggtgtgtatatc
agaatggcagtcttaaaaagagcactgcaaaccaatgcgaaaaggggagaagcggcttat
gtcttatctcattaa

DBGET integrated database retrieval system