KEGG   Bacillus amyloliquefaciens LL3: LL3_01728Help
Entry
LL3_01728         CDS       T01835                                 

Gene name
gmk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    LL3_01728 (gmk)
Enzymes [BR:bql01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     LL3_01728 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1604106..1604720
Genome map
AA seq 204 aa AA seqDB search
MKERGLLIVLSGPSGVGKGTVRQAIFSQEDTKFEYSISVTTRNPREGEVDGVDYFFKSRD
EFERMIENNKLLEWAEYVGNYYGTPVDYVEQTLQEGKDVFLEIEVQGALQVRNAFPEGLF
IFLAPPSLSELKNRIVTRGTETDDLIENRMKAAKAEIEMMDAYDYVVENDDIQTACDKVN
AIVLAEHLKRERVAPRYKKMLEVE
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaagagggttattaatcgttctctcaggtccctcaggagttggaaaaggaacg
gttcggcaagcaatattttcacaagaagacacgaaatttgaatactcaatttcagtcacg
acgagaaacccgagagagggcgaggtcgacggcgtcgattatttctttaaatcaagagat
gaattcgaacgcatgattgaaaacaacaaactgcttgagtgggcggaatatgtcggcaac
tattacggaacgcccgtcgattatgtcgaacagacgcttcaagaaggaaaagacgtcttc
ttagagattgaagtgcagggcgcgctccaagtgcggaatgcatttccggaaggcctgttt
atcttcttagcgccgccgagtctttctgagctgaaaaacagaatcgtgacaagaggaact
gaaaccgacgatttaattgaaaacagaatgaaggccgcaaaagctgaaatcgaaatgatg
gacgcgtatgattatgtcgtggaaaacgatgatatccaaacggcttgtgataaggttaac
gcaattgttctcgccgagcacttaaagcgtgaacgcgttgctccgagatataagaaaatg
ctggaggtagaataa

DBGET integrated database retrieval system