KEGG   Bacillus amyloliquefaciens LL3: LL3_01768Help
Entry
LL3_01768         CDS       T01835                                 

Gene name
sucC
Definition
(GenBank) succinyl-CoA synthetase (beta subunit)
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00020  Citrate cycle (TCA cycle)
bql00640  Propanoate metabolism
bql00660  C5-Branched dibasic acid metabolism
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
Module
bql_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bql_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LL3_01768 (sucC)
   00640 Propanoate metabolism
    LL3_01768 (sucC)
   00660 C5-Branched dibasic acid metabolism
    LL3_01768 (sucC)
Enzymes [BR:bql01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     LL3_01768 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: AEB63308
Position
1641991..1643148
Genome map
AA seq 385 aa AA seqDB search
MNIHEYQGKEVLRKYGVSVPEGKVAFTAEEAVEKAESLSSSVYVVKAQIHAGGRGKAGGV
KIAKTTDEVKEYAEELLGKTLVTHQTGPDGQVIKRLLIEEGCDIKKEYYVGLVLDRATSR
IVLMASEEGGTEIEEVAEKTPEKIKKAVIDPAVGLQGYQAREIAFAINIPKELVGKAAKF
MLGLYKAFVEKDCSIAEINPLVVTGDGNVMALDAKLNFDSNALYRQKDIMEYRDLDEEDP
KEIEASKYDLSYISLDGNIGCMVNGAGLAMSTMDIIKHYGGEPANFLDVGGGATAEKVTE
AFKIILSDQNVKGIFVNIFGGIMKCDVIAEGVVEATRQVGLTLPLVVRLEGTNVDLGKKI
LNESGLNITSAESMADGAQKIVSLV
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccatgagtaccagggaaaagaagtcctcagaaaatacggggtgtctgttcct
gaaggtaaagtggcttttacagcagaggaagcagttgaaaaagcagagagcctgtcaagc
tcggtttatgtcgtaaaggcgcaaatccatgctggcggccgcggcaaagctggtggggta
aagattgcaaaaacaacggatgaagtgaaggagtatgccgaagaactgttaggcaagacg
ctcgtcacacatcaaacgggtccggacggacaagtaataaaacgcttacttattgaagaa
ggctgcgatattaaaaaggaatactacgtcgggcttgtacttgaccgcgccacttcaaga
atcgttttaatggcgtctgaagaaggcggaacggaaattgaagaagtagcggaaaaaaca
cctgaaaaaattaaaaaagcggttattgatccggctgtaggccttcagggctatcaagcg
agggagattgcattcgcaattaacatcccgaaagagcttgtcggcaaagccgctaaattt
atgctcggactatataaagcatttgttgagaaggactgctccatcgccgagatcaaccct
ctcgtcgtcacgggagacggaaacgtcatggcgcttgatgctaagctgaacttcgacagt
aatgcgttatacagacaaaaagacattatggaatacagagatttagatgaagaagatccg
aaagaaatcgaagcctcaaaatacgatttaagctacatttcccttgatggaaatatcggc
tgtatggtaaacggcgcgggtcttgcaatgtctacaatggatatcattaaacactacggc
ggagaacctgcaaacttcctggatgtcgggggcggcgcaaccgctgaaaaagttacggaa
gcttttaaaatcattctttccgatcaaaacgtaaaaggaattttcgttaatattttcggc
ggcatcatgaagtgtgatgtcattgccgaaggcgttgttgaagcgacgagacaagtcgga
ttgacattgccgctggtcgtgcgccttgaagggacaaacgtagatttaggaaagaaaatc
ctgaatgaatcaggcttaaatatcacatctgcggaatcaatggcagacggcgcgcagaaa
atcgtatccttagtttag

DBGET integrated database retrieval system