KEGG   Bacillus amyloliquefaciens LL3: LL3_01930Help
Entry
LL3_01930         CDS       T01835                                 

Definition
Alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LL3_01930
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_01930
  Lipid metabolism
   00071 Fatty acid degradation
    LL3_01930
  Amino acid metabolism
   00350 Tyrosine metabolism
    LL3_01930
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LL3_01930
   00626 Naphthalene degradation
    LL3_01930
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LL3_01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1862012..1863028)
Genome map
AA seq 338 aa AA seqDB search
MKAVIATKDKNIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEIGEGVSSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAVKVPEHLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVEKAKEVTSDLGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFRFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgtaatagcgacgaaagacaaaaatatagcgatcgtacaaaaagaattacgt
cctttgcgacatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgtgacaggcgtcactttaggtcatgaagga
ataggcattgtaaccgagattggtgaaggcgtatcaagcctgaaaaaaggagaccgcgtc
tctattgcgtggatgtttgaaagctgcggccgctgtgaatattgcttaacaggccgtgaa
accctgtgccgtgatgtaaaaaatgccggctatacagttgatggcgcgatggctgaagaa
gcaatcgtagcggttgattatgcagtgaaagtgcctgaacatttagatccggcagcagca
agcagcattacttgtgcaggcgtaacaacttataaagcagtaaaagtcagtgaaattaag
cctggtcaatggatcggtgtatttggagtcggcggtttgggcaacttggctgttcaatat
gcaaagaatgtctttaacgctaaagtgattgctttcgacattagcgatgaaaagttgaat
tttgctaagagcttaggtgctgacgcggttgtaaacagtttaaacgaagaccctgtcgag
aaggctaaagaagtgaccagcgatttaggacttgatgctgcggtcattaccgctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagcgcgagtagttgctgtc
ggtttaccggtagataagatggacttagatattccccgtcttgtgttagatggaattcag
gtagtaggttcattagtaggtaccagagaagacctgaaggaagctttccgattcgctgca
gacggtaaagttgtacctaaagtgacaaagcgcccgatcgaagacgtgaatgatatattt
gaagaaatggagcaaggtaaagtgaccggccgtatggttatagattttacttgttaa

DBGET integrated database retrieval system