KEGG   Bacillus amyloliquefaciens LL3: LL3_01930Help
Entry
LL3_01930         CDS       T01835                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00010  Glycolysis / Gluconeogenesis
bql00071  Fatty acid degradation
bql00350  Tyrosine metabolism
bql00625  Chloroalkane and chloroalkene degradation
bql00626  Naphthalene degradation
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_01930
  Lipid metabolism
   00071 Fatty acid degradation
    LL3_01930
  Amino acid metabolism
   00350 Tyrosine metabolism
    LL3_01930
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LL3_01930
   00626 Naphthalene degradation
    LL3_01930
Enzymes [BR:bql01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LL3_01930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CdhD 2-Hacid_dh_C Methyltransf_25 Methyltransf_31 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AEB63469
Position
complement(1862012..1863028)
Genome map
AA seq 338 aa AA seqDB search
MKAVIATKDKNIAIVQKELRPLRHGEAKVKMEYCGVCHTDLHVKNADFGDVTGVTLGHEG
IGIVTEIGEGVSSLKKGDRVSIAWMFESCGRCEYCLTGRETLCRDVKNAGYTVDGAMAEE
AIVAVDYAVKVPEHLDPAAASSITCAGVTTYKAVKVSEIKPGQWIGVFGVGGLGNLAVQY
AKNVFNAKVIAFDISDEKLNFAKSLGADAVVNSLNEDPVEKAKEVTSDLGLDAAVITAVS
KTPFNQAIDVVKAGARVVAVGLPVDKMDLDIPRLVLDGIQVVGSLVGTREDLKEAFRFAA
DGKVVPKVTKRPIEDVNDIFEEMEQGKVTGRMVIDFTC
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagccgtaatagcgacgaaagacaaaaatatagcgatcgtacaaaaagaattacgt
cctttgcgacatggtgaagccaaagttaagatggaatactgcggtgtatgtcatactgac
ttgcatgttaaaaatgctgatttcggggatgtgacaggcgtcactttaggtcatgaagga
ataggcattgtaaccgagattggtgaaggcgtatcaagcctgaaaaaaggagaccgcgtc
tctattgcgtggatgtttgaaagctgcggccgctgtgaatattgcttaacaggccgtgaa
accctgtgccgtgatgtaaaaaatgccggctatacagttgatggcgcgatggctgaagaa
gcaatcgtagcggttgattatgcagtgaaagtgcctgaacatttagatccggcagcagca
agcagcattacttgtgcaggcgtaacaacttataaagcagtaaaagtcagtgaaattaag
cctggtcaatggatcggtgtatttggagtcggcggtttgggcaacttggctgttcaatat
gcaaagaatgtctttaacgctaaagtgattgctttcgacattagcgatgaaaagttgaat
tttgctaagagcttaggtgctgacgcggttgtaaacagtttaaacgaagaccctgtcgag
aaggctaaagaagtgaccagcgatttaggacttgatgctgcggtcattaccgctgtctct
aaaacccctttcaatcaagcgattgatgttgtaaaagcaggagcgcgagtagttgctgtc
ggtttaccggtagataagatggacttagatattccccgtcttgtgttagatggaattcag
gtagtaggttcattagtaggtaccagagaagacctgaaggaagctttccgattcgctgca
gacggtaaagttgtacctaaagtgacaaagcgcccgatcgaagacgtgaatgatatattt
gaagaaatggagcaaggtaaagtgaccggccgtatggttatagattttacttgttaa

DBGET integrated database retrieval system