KEGG   Bacillus amyloliquefaciens LL3: LL3_02016Help
Entry
LL3_02016         CDS       T01835                                 

Gene name
yngB
Definition
UTP-sugar-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LL3_02016 (yngB)
   00052 Galactose metabolism
    LL3_02016 (yngB)
   00500 Starch and sucrose metabolism
    LL3_02016 (yngB)
   00520 Amino sugar and nucleotide sugar metabolism
    LL3_02016 (yngB)
Enzymes [BR:bql01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LL3_02016 (yngB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1960398..1961291
Genome map
AA seq 297 aa AA seqDB search
MRKKVRKAVIPAAGLGTRFLPATKAQPKEMLPIVDKPAIQYIVEEAAESGIEDILIITGR
NKRSIEDHFDRLAELEFNLQEKGKTEMLKEMQQIADLANIHYIRQKEPLGLGHAVLCAEH
FIGDEPFAVLLGDDIMVSDTPALSQLIDVYNQHGTETIGVQPVEPADVSKYGIIQTGRQS
GHVYQVEDLIEKPAAEKAPSRIAVMGRYILTPAIFQALKTIGRGAGSEIQLTDALRKVCR
TRSIYARELEGSRFDIGDKLGCFKAGTEIGLLRKEMRPKLLAYLEEVLKRESEEMTH
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaagtgagaaaagcggtcatccccgcagcgggtttaggcacgagatttctg
ccggcgacaaaggcgcagccgaaagaaatgctgccgattgtcgacaaaccggcaatccaa
tatattgtagaagaggccgcagaatcaggaattgaagatatactgattattacggggaga
aacaaacgctcgattgaagatcattttgaccggttggcggaattggaattcaatctgcag
gaaaaaggcaagacggagatgcttaaggaaatgcagcagattgccgatttggccaatatt
cattacatccgccagaaagagccgctcggcttaggacatgcggtattgtgtgcggagcat
tttatcggagatgagccttttgccgttctcttaggagatgatattatggtatctgacacc
cccgcgctttcgcagctcatagacgtctataaccagcacggcacagaaacaatcggcgta
cagcccgtcgagcctgctgatgtcagcaaatatggtattatacagacggggcggcaaagc
ggtcatgtgtatcaggttgaagacctgattgagaagccggctgctgaaaaggcgccctca
cgtattgccgtgatgggccgatacatattaacccctgccattttccaggcgctcaaaacg
atcggacgaggcgcgggcagcgaaatccaattaactgatgcgctgcgcaaagtgtgccgc
acccggagcatttacgcgcgggaacttgaaggaagccggttcgatataggcgataagctc
gggtgttttaaagccgggacggagatcgggcttctgcggaaagaaatgagaccgaaactt
ttagcttatttagaagaggtgttaaaaagagaatctgaagaaatgacgcattaa

DBGET integrated database retrieval system