KEGG   Bacillus amyloliquefaciens LL3: LL3_02108Help
Entry
LL3_02108         CDS       T01835                                 

Gene name
odhB
Definition
2-oxoglutarate dehydrogenase complex (dihydrolipoamide transsuccinylase, E2 subunit)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LL3_02108 (odhB)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LL3_02108 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    LL3_02108 (odhB)
Enzymes [BR:bql01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LL3_02108 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2054116..2055363)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPAKEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQTKPQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNEVK
LGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEKEIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaacttgagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacctgccccttccgaaagtgctccagccaaagaacaaacgaaagaggaa
gcaaaagctgaaccggctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctttca
caaattccgacgggggacccgctcggccgcgtgcgcaaacaagacgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagacgaaaccgcaggctcaaaaaacacagcaaagc
tttgacaaacctgttgaagtgcaaaaaatgtcccgccgcagacaaacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgacgacatttaacgaagtggacatgacg
gctgttatgaatttaagaaaacgccgtaaagaccaattccttgagcaaaacgaagtaaaa
ctcggtttcatgtctttctttacaaaagccgtagtggcagctttgaaaaagtacccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gccgttgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgatcgtctgaca
tttgccggcattgaaaaagagatcggcgaacttgcgaagaaagcacgaaacaataaatta
acattaggtgagctgcaaggaggttccttcacgatcacaaacggaggtacattcggctcg
cttatgtcaacaccaatcctaaacagccctcaggtcggaatcttaggtatgcacaaaatt
cagctgcgccctgtagcgatcgatgcagagcgttctgaaaaccgtccgatgatgtacctt
gctttatcatatgatcacagaatcgtagatggtaaagaagcggtcggattccttgtcaca
attaaaaacctgctggaagatccggaacagctgttattggaaggataa

DBGET integrated database retrieval system