KEGG   Bacillus amyloliquefaciens LL3: LL3_02108Help
Entry
LL3_02108         CDS       T01835                                 

Gene name
odhB
Definition
(GenBank) 2-oxoglutarate dehydrogenase complex (dihydrolipoamide transsuccinylase, E2 subunit)
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
bql00020  Citrate cycle (TCA cycle)
bql00310  Lysine degradation
bql01100  Metabolic pathways
bql01110  Biosynthesis of secondary metabolites
bql01120  Microbial metabolism in diverse environments
bql01130  Biosynthesis of antibiotics
bql01200  Carbon metabolism
Module
bql_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bql_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LL3_02108 (odhB)
  Amino acid metabolism
   00310 Lysine degradation
    LL3_02108 (odhB)
Enzymes [BR:bql01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     LL3_02108 (odhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: AEB63645
Position
complement(2054116..2055363)
Genome map
AA seq 415 aa AA seqDB search
MAEIKVPELAESISEGTIAQWLKQPGDYVEQGEYLLELETDKVNVELTAEESGVLKEVLK
DSGDTVQVGEIIGTITEGAGESSAPAPSESAPAKEQTKEEAKAEPAAQEVSQEAQSEAKS
RTVASPAARKLAREKGIDLSQIPTGDPLGRVRKQDVEAYEKPASKPAAQTKPQAQKTQQS
FDKPVEVQKMSRRRQTIAKRLVEVQQTSAMLTTFNEVDMTAVMNLRKRRKDQFLEQNEVK
LGFMSFFTKAVVAALKKYPLLNAEIQGDELIVKKFYDIGIAVAAEEGLVVPVVRDADRLT
FAGIEKEIGELAKKARNNKLTLGELQGGSFTITNGGTFGSLMSTPILNSPQVGILGMHKI
QLRPVAIDAERSENRPMMYLALSYDHRIVDGKEAVGFLVTIKNLLEDPEQLLLEG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaattaaggtacctgaattagcagaatcaatctcagaaggaacgatagcccaa
tggttaaagcagcccggtgattatgtagaacagggtgagtacttgcttgaacttgagacg
gacaaagtaaatgttgaattgacagcagaagaatcgggtgttctaaaagaggtattgaaa
gattcgggtgataccgtccaagtaggagaaattatcggtaccattacagaaggcgctggc
gaaagttctgcacctgccccttccgaaagtgctccagccaaagaacaaacgaaagaggaa
gcaaaagctgaaccggctgcacaagaagtcagccaggaagcacaatcagaagcgaaatcc
agaacggtagcgtctccggctgcacgcaagctggcaagggaaaaaggaattgatctttca
caaattccgacgggggacccgctcggccgcgtgcgcaaacaagacgtggaagcttatgaa
aaaccggcttcaaaacctgcggcacagacgaaaccgcaggctcaaaaaacacagcaaagc
tttgacaaacctgttgaagtgcaaaaaatgtcccgccgcagacaaacgatcgcgaaacga
ttggttgaagtgcagcagacttctgcgatgctgacgacatttaacgaagtggacatgacg
gctgttatgaatttaagaaaacgccgtaaagaccaattccttgagcaaaacgaagtaaaa
ctcggtttcatgtctttctttacaaaagccgtagtggcagctttgaaaaagtacccgctc
cttaacgctgaaattcaaggcgatgagctgatcgtgaaaaaattctatgacatcggtatc
gccgttgcggctgaagaagggcttgtcgtcccagtcgtgcgtgacgctgatcgtctgaca
tttgccggcattgaaaaagagatcggcgaacttgcgaagaaagcacgaaacaataaatta
acattaggtgagctgcaaggaggttccttcacgatcacaaacggaggtacattcggctcg
cttatgtcaacaccaatcctaaacagccctcaggtcggaatcttaggtatgcacaaaatt
cagctgcgccctgtagcgatcgatgcagagcgttctgaaaaccgtccgatgatgtacctt
gctttatcatatgatcacagaatcgtagatggtaaagaagcggtcggattccttgtcaca
attaaaaacctgctggaagatccggaacagctgttattggaaggataa

DBGET integrated database retrieval system