KEGG   Bacillus amyloliquefaciens LL3: LL3_03734Help
Entry
LL3_03734         CDS       T01835                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    LL3_03734 (rbsK)
Enzymes [BR:bql01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     LL3_03734 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3515312..3516193
Genome map
AA seq 293 aa AA seqDB search
MSEICVIGSCSMDLVVTSERRPKAGETVLGADFQTVPGGKGANQAVAASRLGANVYMVGK
AGSDSYGKAIIENLQANGVNTDYMETITHKKSGTAHIVLAEGDNSIVVVKGANDDISPAY
AKRALAKLPGIDIVLIQQEIPEETVEEVCSYCRAHQIPVILNPAPARPLKQSTIENAAYL
TPNEHEASILFPDRTKEEALAGYPGKLFITEGKQGVRYSDGTAERLVPAFPVEAVDTTGA
GDTFNAAFAVALAEGQDIEQALLFANRAASLSVQHFGAQGGMPARKEVEELLS
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgaaatttgtgttatcggcagctgttctatggatcttgttgtcacatctgaacga
cgcccgaaagcgggagaaaccgtactgggcgcagactttcaaaccgtgcccggaggaaaa
ggcgccaatcaggccgtagcagcttcccgcctgggcgcaaacgtatatatggtaggaaaa
gcaggcagtgacagttacggaaaagcgattattgaaaatctgcaggcaaacggtgtcaat
acggactatatggaaacgattacacacaaaaaaagcggaacggctcatattgtgctcgca
gaaggagataacagcatcgtcgtcgtaaaaggcgcaaacgatgacatctcccctgcttat
gccaaaagagcgctcgcgaaacttcccggcattgacattgtgctgatccagcaggagatc
cctgaagaaaccgttgaagaagtgtgcagctactgccgcgcgcatcaaattccggttatc
ctgaatccggcgccggcccgcccgctgaaacaatcaaccattgagaatgccgcttatctt
acgccgaacgaacatgaagcatccattttatttcctgaccggacgaaagaagaagcgctc
gccggctatcccggcaaattgtttattaccgaaggaaaacaaggcgtgcggtactcagac
ggcaccgcggaacggctcgttcccgccttccctgttgaagcggtcgacacgacgggagcc
ggcgatacctttaatgcggcatttgccgtcgcactcgcggaaggacaggacatcgaacaa
gcgcttctgtttgccaaccgcgccgcctccctgtccgtgcagcacttcggcgcccaaggc
ggcatgcctgccagaaaagaagtcgaggagctgctgtcatga

DBGET integrated database retrieval system