KEGG   Bacillus amyloliquefaciens LL3: LL3_04020Help
Entry
LL3_04020         CDS       T01835                                 

Gene name
gmuD
Definition
mannoside-phospho-beta-d-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:bql00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LL3_04020 (gmuD)
Enzymes [BR:bql01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LL3_04020 (gmuD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3764600..3766000
Genome map
AA seq 466 aa AA seqDB search
MTESVVQYRFPEGFWWGSSASATQTEGAADRDGKSQNIWDYWYEREPSRFFNGVGPGDTS
RFYDKYKEDIRLMKEIGHNSFRLSISWSRLIPDGTGEINQKAAAFYQNVIDEMLAHHIEP
FVNLFHFDMPLALQRSGGWVSRNTVDAFEHYAKTCFSLFGGKVKKWFTHNEPIVPIEGGY
LYDFHYPNHVNFQEAVQAGFHTLLSNARAVKAYRELKQDGQIGIILNLTPSYPRSSHPED
LKAARIADAFFNRSFLDPAVKGEFPSELVEILKAEGFLPRYEKDDLRLIQEHTIDLLGVN
YYQPRRVKAKEHVPNPHAPFLPERFFDPYVMPGRKMNPHRGWEIYEKGIYDILTNLREHY
GNIECFISENGMGVEGEERFRDEDGIIQDDYRIEFIKEHLKWVHRAIGEGSNVKGYHLWT
FMDNWSWTNAYKNRYGFVSVNLENGGGRTVKKSGRWFKSVSDQNGF
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
ttgactgaatcagttgttcaataccgttttccggaaggattttggtgggggtcttccgcc
tccgcaacccaaaccgagggagccgccgacagagacggaaaaagccagaacatatgggat
tactggtatgaaagagagccaagccgtttttttaacggagtcggccccggcgacacgtca
cgtttttacgacaaatacaaagaagatatccggctgatgaaagaaatcggccacaactct
ttccggctgtctatttcctggtcaagactgattccggacggaacgggtgagatcaatcag
aaggcggccgcgttttaccagaacgtcatcgatgaaatgctcgcccatcacattgagccg
tttgtcaatttgtttcattttgacatgccgctcgcccttcagcgttcagggggctgggtc
agccggaacaccgttgacgcgtttgagcattacgccaaaacctgcttttcgttattcggc
ggcaaggtaaaaaaatggttcactcacaatgagccgattgtgccgattgaaggcggctat
ttatatgattttcactatccgaatcacgttaattttcaagaagcagtgcaggcaggtttc
cacaccctgctgtcaaatgcaagagctgttaaagcctacagagaattaaagcaggacggg
caaatcggaatcattctgaatctgacgccttcttatccgagaagctctcatcctgaagac
ctgaaagcggcccggattgccgacgccttttttaaccgatcatttttagatccagcagta
aagggcgaatttcctagtgagcttgttgagattctcaaagcggaaggatttctgccgcgt
tatgagaaggatgatctccgcctcattcaggagcatacgatcgatctgctaggcgtgaac
tactatcagccgagacgcgtcaaagcaaaagaacatgttccgaatccgcatgcccctttc
ctgcctgagcgtttcttcgatccgtatgtcatgcccggccggaaaatgaaccctcatcgc
gggtgggaaatttacgaaaaaggaatctatgacattctcaccaacctcagagaacattac
ggcaatatcgagtgttttatttctgaaaacggcatgggagttgaaggcgaggaacgcttc
cgcgatgaagacggcatcattcaggatgattacaggattgaatttattaaagaacatctc
aaatgggtgcaccgggccatcggggaaggttcaaatgtaaaaggctatcatctgtggact
ttcatggacaactggtcttggacaaatgcttataaaaaccgctacggctttgtatctgtc
aatctggaaaacgggggcggacggaccgtcaaaaaaagcggacgctggttcaaatccgtt
tccgatcaaaacggcttttaa

DBGET integrated database retrieval system