KEGG   Bacillus amyloliquefaciens LL3: LL3_04147Help
Entry
LL3_04147         CDS       T01835                                 

Gene name
fbp
Definition
fructose-1,6-bisphosphatase
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
bql  Bacillus amyloliquefaciens LL3
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:bql01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:bql00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:bql00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:bql00051]
Metabolism; Energy metabolism; Methane metabolism [PATH:bql00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3899046..3900971
Genome map
AA seq 641 aa AA seqDB search
METKYLDLLAQKYDCEEKVVTEIINLKAILNLPKGTEHFVSDLHGEYQAFQHVLRNGSGR
VKEKIRDIFSGVIYDREIDELAALVYYPEDKLKLIKHDFDTKEALNDWYEETIHRMIKLV
SYCSSKYTRSKLRKALPAQFAYISEELLYKTEQAANKEQYYSEIIEQIIALGQADKLITG
LAYSTQRLVVDHLHVVGDIYDRGPQPDKIMEELINYHSVDIQWGNHDVLWIGAYSGSKVC
LANIIRICARYDNLDIIEDVYGINLRPLLNLAEKYYDDNPSFRPKADENRPEDEIKQITK
IHQAIAMIQFKLESPIIKRRPNFNMEERLLLEKIDYDRNEITLNGKTYQLENTCFATVNP
KQPDELLEEEAEVMDKLLFSVQHSEKLGRHMNFMMKKGSLYLKYNGNLLIHGCIPVDENG
SMETMMIEDKAYAGRELLDVFERFLRNAFAHPEETDDLATDMVWYLWTGEYSSLFGKRAM
TTFERYFIKEKETHKEKKNPYYYLREDEATCRNILKEFGLNPDHGHIINGHTPVKEIEGE
DPIKANGKMIVIDGGFSKAYQSTTGIAGYTLLYNSYGMQLVAHKHFNSKAEVLSTGTDVL
TVKRLVDKELERKKVKETNVGEELLKEVAILEKLREYRYMK
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
ttggaaacgaaatatttagatctgctcgcacaaaaatacgattgtgaagaaaaagtggtc
acagaaatcataaatctgaaagcaatactgaacctgccgaaaggaaccgagcatttcgtc
agtgatttgcacggggagtatcaggcattccagcacgtgctgcggaatggttcaggaaga
gtaaaagagaagatccgcgatattttcagcggtgtcatttacgatagagaaattgatgaa
ctggcagcattggtctattatccggaagacaaactcaaattaatcaaacatgactttgat
acaaaagaagcattaaacgattggtatgaagaaacgattcatcgaatgattaagctcgtt
tcttattgctcttccaaatacacccgctccaaattgcgcaaggcgctgcctgcccaattt
gcttatatttctgaagagctgctgtacaaaacagaacaagccgccaacaaggaacaatat
tattccgaaatcatagaacaaatcattgcgctcggccaagccgataagctgatcaccggt
cttgcatacagcacgcagcgattggtggtcgaccatctgcatgttgtcggcgatatttac
gaccgcggaccccagcctgataaaattatggaagaactgatcaactatcattcagtggat
attcaatgggggaatcatgatgttctctggataggcgcctattccggctcgaaggtatgc
ctggccaatattatccgcatctgtgcccgctatgacaacctggatattattgaagacgtc
tacggcatcaacctgagaccgctcttgaacctggccgaaaaatattatgatgataacccg
tctttccgcccgaaagcggatgaaaacagaccagaagatgaaattaagcaaatcacaaaa
attcatcaggcgatcgcgatgatccaattcaagcttgagagcccgattatcaagagacgg
ccgaactttaacatggaggaacggctgttactggaaaagattgattatgatcgaaatgaa
atcacgctgaacggaaaaacatatcaactggaaaacacctgctttgcgacggttaatcca
aagcagccggatgagctattagaggaagaagcggaagtcatggacaagctgctgttctct
gttcagcattccgaaaagctgggccgccatatgaactttatgatgaaaaaaggcagcctt
tacttaaaatacaacggcaacctattgattcacggctgtattcctgtcgacgaaaacggc
agcatggaaacgatgatgattgaggataaagcctatgcgggccgtgagctgctcgatgta
tttgaacggttcttacggaatgccttcgcccacccggaagaaaccgatgatctggcgaca
gacatggtctggtatttatggacaggcgagtattcctccctcttcggaaaacgcgccatg
acgacctttgagcggtatttcattaaagagaaagaaacgcataaagaaaagaaaaacccg
tattactatttgcgcgaagacgaggcaacctgccgaaacatcctgaaagagttcggtctc
aacccggatcacggccatatcatcaacggccatacaccggtaaaagaaatcgaaggcgaa
gatccgatcaaagcaaacggaaaaatgatcgtcatcgacggaggcttctctaaagcctac
caatccacaacaggcatcgccggctacacgctcttatacaactcttacggcatgcagctc
gtcgcccataaacactttaactcaaaggccgaagtgctgagcaccggaaccgacgtctta
acagtgaaacgcttagtcgacaaagagctggagcggaagaaagtaaaagaaacgaatgtt
ggcgaggaactgctgaaggaagtggctattttggagaaactgcgggagtatcggtatatg
aagtga

DBGET integrated database retrieval system